KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM003580Help
Entry
Phum_PHUM003580   CDS       T01223                                 

Definition
(RefSeq) histone H2B.3, putative
  KO
K11252  histone H2B
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Phum_PHUM003580
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM003580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF3915
Motif
Other DBs
NCBI-GeneID: 8233374
NCBI-ProteinID: XP_002422634
VectorBase: PHUM003580
UniProt: E0V940
AA seq 146 aa AA seqDB search
MPPKATGKAVKKAGKAQKNISKGDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLSHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
RCVLLTELSFILYERVFCFVALKRAV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaagcaaccggaaaagccgtcaaaaaggccggaaaggctcagaaaaacatc
tctaagggagacaaaaagaagaaaaggaggaggaaggaaagttatgccatttacatctac
aaagttctcaagcaagttcatcccgacactgggatttcgagcaaagccatgagcatcatg
aactctttcgtaaacgacatattcgaaagaatcgctgctgaagcttccagattatctcac
tacaacaaaagatcgaccatcacaagtcgggaaattcaaacggctgttcgtctcttgttg
ccgggagaattggcaaaacacgctgtgagcgaaggaaccaaagctgtgaccaaatacaca
agatgtgttttattaaccgagctaagctttatcttgtatgaacgtgttttctgttttgtg
gcccttaaaagggccgtttga

DBGET integrated database retrieval system