KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM009100Help
Entry
Phum_PHUM009100   CDS       T01223                                 

Definition
cyclin H, putative
Orthology
K06634  
cyclin H
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Phum_PHUM009100
  Replication and repair
   03420 Nucleotide excision repair
    Phum_PHUM009100
Transcription machinery [BR:phu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Phum_PHUM009100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 155 aa AA seqDB search
MYPVSSQKKNWTFSDELEIEKLRKGANERFIEKFGRGKTEDEKKSFFLTPEEELILLKGS
ELLLREFCRKFSPPMPKSVIGTSYHYFKRFYINNSVMDYHPKEILVTCVYLSCKVEEFNI
SIAQFVSNIKGDREKAAEIILNNELLLMQQLNYYL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccgtaagctcacaaaaaaaaaattggactttttctgatgaattagaaatagaa
aagttgagaaaaggggccaatgaaagatttattgagaaatttggaagagggaaaacggaa
gatgaaaaaaaatcattctttttaactcctgaggaagaattaattttacttaagggctct
gaattgttattacgagaattttgtagaaagttttcaccaccaatgcctaaaagtgttatc
ggaacttcttaccattattttaaaagattttacataaataattcagtcatggattatcat
ccgaaagaaatattagtcacatgtgtttatttatcatgtaaagttgaagaatttaatatt
tccatagctcaatttgtttcaaatataaaaggtgatagagaaaaagctgcagaaataata
ttaaataatgaattgcttttaatgcaacaattaaattattactta

DBGET integrated database retrieval system