KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM019510Help
Entry
Phum_PHUM019510   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Phum_PHUM019510
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Phum_PHUM019510
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Phum_PHUM019510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 275 aa AA seqDB search
MSIADFDIGKPLGKGKFGNVYLAREKNSKFITALKVLFKSQLEKAKVVHQLKREVEIQSH
LRHPNILRLYGYFHDDARVYLILEYAPNGELFKLLQSQPEKRLDEKRTATFIAQIADALN
YCHSKKVIHRDIKAENLLIGAKGEIKIADFGWAVHSPLSRRDTICGTPDYLPPEMICNKT
HDHTVDIWSVGVLCYECLVGKTPFENNHIKETYKNIVQGKFSFPCFVSEGARDLICKMLV
RNPSGRLPFDKVIEHPWVLANSSAVTPWFSSRSHS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagctgattttgatataggaaagcccttaggaaaaggaaaatttggaaacgtt
tatttagccagagaaaaaaattccaaatttataactgcattaaaagttttatttaagtct
cagttggaaaaagccaaagttgttcatcaacttaaaagagaagttgaaattcaatcacat
ttacgccatccaaatattttaagattatatggatattttcacgatgatgctagagtttat
ttaatattagaatatgctccaaatggggagttatttaagctattacagtcacaacctgaa
aaaagattagatgaaaaaagaactgcgacatttattgctcaaattgctgatgcccttaat
tactgccattcgaaaaaagttattcacagagatataaaagcagaaaatttattaattgga
gcaaaaggtgaaattaaaattgctgatttcggttgggcagttcattcacctttgtcaaga
cgtgatacaatttgtggcactcccgattatcttcctcctgaaatgatttgcaataaaaca
catgatcatacagtagatatttggagtgttggagttttatgttatgaatgtttagttgga
aaaactccattcgaaaataatcacatcaaagaaacttataaaaatatagttcagggaaaa
ttttcatttccttgtttcgtttctgaaggtgcaagagatttaatttgcaagatgcttgta
agaaatccaagtggacgattaccatttgataaagttattgagcatccttgggttttagca
aattcttctgctgtaactccatggttttcatctagaagtcattcataa

DBGET integrated database retrieval system