KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM022230Help
Entry
Phum_PHUM022230   CDS       T01223                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 225 aa AA seqDB search
MAWVPLEANPDVMNTFLYRLGVPQKIKVVDVFGLDPELLAIIPQPVLGLLLLFPCDDKYE
EYKNKQEQELKKKGQVVSNKLYFMKQFVHNACGTIALIHSIANIENLDLGDGFLKQFLDD
TRSLSPDQRGEELQKCNAIIDTHSEVANEGQTAPPDNRIPVLYHFVAFVQKEGNLYELDG
RKAFPINLGPSSPDTFLQDAALACRNYMKRNPENVNFTVVAVTAE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggttcctttagaagctaatccagatgttatgaacacgtttctttacagactt
ggagtgcctcaaaaaattaaagtcgtcgacgtatttggtctcgatccagaattattggca
ataataccacagccagtattaggacttcttttattgtttccttgtgatgataaatatgaa
gaatataaaaataaacaggaacaagaattaaaaaaaaaaggacaagttgtatctaacaag
ttatatttcatgaagcagtttgtacataatgcttgtggtacgattgctctcattcatagc
attgctaatattgaaaatttagatttaggagatggatttctcaaacaatttttagatgat
acaagatcattatctcctgatcagagaggagaagaattgcaaaaatgtaatgctattata
gatactcattctgaagtagctaacgaagggcaaacagctccccccgataataggatacct
gttttatatcattttgtggctttcgttcaaaaagaaggaaatttatatgaattagatggg
aggaaagcatttccaataaatcttggcccatcgtcacctgatacttttctccaagatgct
gctttagcttgtcgtaattacatgaaacgaaatcctgaaaatgttaactttactgttgtc
gcagtgactgcagaataa

DBGET integrated database retrieval system