KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM029040Help
Entry
Phum_PHUM029040   CDS       T01223                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2, putative (EC:2.7.11.17)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:phu04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:phu04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:phu04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 503 aa AA seqDB search
MAEKSESVIRPIMKIGHYTLGQTLGVGTFGKVKKHQLTKHKVAVKILNRQKIKSLDVVGK
IRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYILKEHEARRFFQQIIS
GVDYCHRHMVVHRDLKPENLLLDHNLHVKIADFGLSNMMMDGEFLRTSCGSPNYAAPEVI
SGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIKSGIFPIPEYLNKSVVSLL
CHMLQIDPIKRASIDDIKKHDWFQKELPAYLFPSPVEQDSSVIDTDAIIEVCEKFGVKEG
EVHSALLNGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVASSPPPASFSPNEMNPSP
VRPHPERIALLSSSLTSQSSERLIPKGTPVKRAKWHLGIRSQSKPHDIMNEVYRAMKALD
FEWKVINPYHVRVRRKHSVNGFTKMSLQLYQVDFKSYLLDFKSLSSDSEEAESLSADPLQ
QTAGHHTMEFFEMCAALITQLAR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaaagtgaatctgtaattcgaccgattatgaaaatcggtcattatacgtta
gggcagacattaggcgttggaacttttggcaaagtaaaaaaacatcaattaactaaacat
aaagtagcagttaaaatattaaatagacaaaaaatcaaaagcctagatgttgttggaaaa
attagaagagaaattcaaaatttaaaattgtttagacatccacacataattaaactgtat
caagtaatttctactccgacagatatttttatgattatggaatatgtttcaggaggagaa
ttatttgattatattctcaaagaacatgaagccaggagattttttcaacaaattatatca
ggagttgattattgtcataggcatatggttgttcacagggatttaaaacctgagaatctt
ttactcgatcacaatttgcatgttaaaattgcagattttggtttgtcaaatatgatgatg
gatggtgaatttttaagaacaagttgtggatcaccaaattatgctgctccagaagtaata
tcggggaaattatatgcaggtcctgaagttgatatttggagttgtggtgttattttatat
gctcttctctgtggaactctgccttttgatgatgaacatgtgccaactttatttaaaaaa
attaaatctggaatatttccaataccagaatacttgaacaaatcagttgtaagtttatta
tgtcatatgctacaaatagatccaatcaaaagagcttcaatagatgatataaaaaaacat
gattggtttcaaaaagaattaccagcttatttgtttccatctccagtcgaacaagattca
tcagttattgatactgatgctattattgaagtatgcgaaaaatttggtgtaaaagaggga
gaagttcatagtgctcttcttaatggagatcctcatgatcaattagccatagcttatcat
ttaataattgataataagagaatagcagatgaagctgctaaagcggaattaaaagatttt
tatgttgctagtagccctcctccagcatcattttcaccgaacgaaatgaatcctagtcct
gttcgccctcacccggaaagaatagctcttttgagtagctctttaacttctcagtctagt
gaaagattaattccaaaaggtacgcctgtaaaaagagccaaatggcatttaggaattcgt
tctcaaagtaaacctcacgatatcatgaatgaagtttatagagccatgaaagctttagat
tttgaatggaaagtaataaatccgtaccacgttagagtccggcgaaaacacagtgttaat
ggttttacaaaaatgtctttgcaactttatcaagtagattttaaaagttatcttttagat
tttaaaagtctcagttcagattcagaggaagcagaatcactatcggcagatcctttgcaa
caaacagcggggcatcatacaatggaattttttgaaatgtgtgctgctcttatcactcag
ttggctcgttga

DBGET integrated database retrieval system