KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM029040Help
Entry
Phum_PHUM029040   CDS       T01223                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2, putative (EC:2.7.11.17)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Phum_PHUM029040
   04150 mTOR signaling pathway
    Phum_PHUM029040
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Phum_PHUM029040
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM029040
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Phum_PHUM029040
Mitochondrial biogenesis [BR:phu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Phum_PHUM029040
  Mitophagy factors
   Other mitophagy factors
    Phum_PHUM029040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 503 aa AA seqDB search
MAEKSESVIRPIMKIGHYTLGQTLGVGTFGKVKKHQLTKHKVAVKILNRQKIKSLDVVGK
IRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYILKEHEARRFFQQIIS
GVDYCHRHMVVHRDLKPENLLLDHNLHVKIADFGLSNMMMDGEFLRTSCGSPNYAAPEVI
SGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIKSGIFPIPEYLNKSVVSLL
CHMLQIDPIKRASIDDIKKHDWFQKELPAYLFPSPVEQDSSVIDTDAIIEVCEKFGVKEG
EVHSALLNGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVASSPPPASFSPNEMNPSP
VRPHPERIALLSSSLTSQSSERLIPKGTPVKRAKWHLGIRSQSKPHDIMNEVYRAMKALD
FEWKVINPYHVRVRRKHSVNGFTKMSLQLYQVDFKSYLLDFKSLSSDSEEAESLSADPLQ
QTAGHHTMEFFEMCAALITQLAR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaaagtgaatctgtaattcgaccgattatgaaaatcggtcattatacgtta
gggcagacattaggcgttggaacttttggcaaagtaaaaaaacatcaattaactaaacat
aaagtagcagttaaaatattaaatagacaaaaaatcaaaagcctagatgttgttggaaaa
attagaagagaaattcaaaatttaaaattgtttagacatccacacataattaaactgtat
caagtaatttctactccgacagatatttttatgattatggaatatgtttcaggaggagaa
ttatttgattatattctcaaagaacatgaagccaggagattttttcaacaaattatatca
ggagttgattattgtcataggcatatggttgttcacagggatttaaaacctgagaatctt
ttactcgatcacaatttgcatgttaaaattgcagattttggtttgtcaaatatgatgatg
gatggtgaatttttaagaacaagttgtggatcaccaaattatgctgctccagaagtaata
tcggggaaattatatgcaggtcctgaagttgatatttggagttgtggtgttattttatat
gctcttctctgtggaactctgccttttgatgatgaacatgtgccaactttatttaaaaaa
attaaatctggaatatttccaataccagaatacttgaacaaatcagttgtaagtttatta
tgtcatatgctacaaatagatccaatcaaaagagcttcaatagatgatataaaaaaacat
gattggtttcaaaaagaattaccagcttatttgtttccatctccagtcgaacaagattca
tcagttattgatactgatgctattattgaagtatgcgaaaaatttggtgtaaaagaggga
gaagttcatagtgctcttcttaatggagatcctcatgatcaattagccatagcttatcat
ttaataattgataataagagaatagcagatgaagctgctaaagcggaattaaaagatttt
tatgttgctagtagccctcctccagcatcattttcaccgaacgaaatgaatcctagtcct
gttcgccctcacccggaaagaatagctcttttgagtagctctttaacttctcagtctagt
gaaagattaattccaaaaggtacgcctgtaaaaagagccaaatggcatttaggaattcgt
tctcaaagtaaacctcacgatatcatgaatgaagtttatagagccatgaaagctttagat
tttgaatggaaagtaataaatccgtaccacgttagagtccggcgaaaacacagtgttaat
ggttttacaaaaatgtctttgcaactttatcaagtagattttaaaagttatcttttagat
tttaaaagtctcagttcagattcagaggaagcagaatcactatcggcagatcctttgcaa
caaacagcggggcatcatacaatggaattttttgaaatgtgtgctgctcttatcactcag
ttggctcgttga

DBGET integrated database retrieval system