KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM033940Help
Entry
Phum_PHUM033940   CDS       T01223                                 

Definition
1,4-alpha-glucan branching enzyme, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Phum_PHUM033940
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Phum_PHUM033940
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM033940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 691 aa AA seqDB search
MDPMEVEVPDISTLFKRDPWLQPYEKEIRKRYAIFKDFLDKIVEKEGSIEKFSEGYKYYG
MIFNEDNSVTCREWAPGASELYLMGEFNNWNRNSHKFEKLPYGKWELTLPPNPDGSCLIT
HLSETKLIVRNQNNEELERLSPWASYVVQPPENEGYLFKQKAWKPNAPYKFKYDKVKRPE
SLRIYECHVGIASSEPKIGTYKEFANNIIPRITKLGYNAIQLMAVMEHAYYACFGYQVTS
FFAASSRFGTPDDLKELVDAAHAAGLYVLLDIINSHASKNTLDGLNQFDGTDSCYFHSGS
RGVHQLWDCRMFNFSEYEVVRFLLSTLRWYIDEYNFDGYRFDAITAMLYHSRGIGEGFSG
NYDEYFGLNVDTDAIVYLMLANHMLHKMYPDVVTIAEDVSGMASQCRPVEEGGIGFDYRL
GMAIPDKWIKLLKEVRDEDWNMGNIVHTLTNRRWMEKTIAYVESHDQALVGDKSVAFWLM
DKEMYTHMSVLSEPNIIIDRGISLHKMIRLITHGLGGEAYLNFMGNEFGHPEWLDFPREG
NNNSYFYARRQWNLVDDDLLKYKFLNNFDAAMNQLEEKYGWLHKDSGFVSCKHEDDKIIA
FERAELLFLFNFHPHKSFTNYRVGVELPGNYKILLSSDDSDYGGFGRIDTSLTYSTSSEG
SHGRKNSLLVLPQRTIVPYIKASKIKNFFFL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggatccaatggaagtcgaagtacctgatatttctacactttttaaaagagatccttgg
cttcagccatacgaaaaagaaattagaaaaagatatgcaatatttaaagattttttggat
aaaattgtcgaaaaggaaggaagcatagaaaaattttcagaagggtacaaatattatgga
atgatatttaatgaagataattctgtaacttgcagagaatgggccccaggagcttctgaa
ctttatttaatgggagaattcaataactggaacaggaatagtcacaaatttgaaaaatta
ccttatggaaaatgggagttaaccttacctcctaatcctgatggttcatgtttaataact
catttatctgaaactaagttaattgttcgcaatcaaaataatgaagaactggaaaggtta
tctccatgggcttcatatgtagttcaaccaccagaaaatgaaggttatctttttaaacag
aaagcttggaagccaaatgctccatataaatttaaatacgataaagttaaaagacctgaa
agtcttagaatatatgaatgccatgttggtattgcatcttctgaaccgaaaattggaacc
tacaaagaattcgctaataacatcattcccagaatcacaaaattagggtataatgctatc
caattaatggctgtcatggagcatgcatattatgcttgttttggatatcaagtcaccagt
ttttttgctgcttccagtcgattcggaacgccagacgatctaaaagaacttgttgatgct
gctcacgctgctggattgtatgtcttattagacatcattaattctcatgcttcaaaaaat
actttggatggattgaatcaattcgatggaactgatagttgttattttcatagtggttca
agaggagttcatcagctttgggattgcagaatgtttaatttttcagaatatgaagttgtc
agatttttattgtcaacgttaagatggtatattgatgaatataattttgacggttatcgg
tttgatgccatcacggccatgttataccacagtagaggaatcggggaaggatttagtgga
aattacgatgaatatttcggtttaaatgtagatacggacgctattgtctacttaatgttg
gcaaaccacatgcttcataaaatgtatcccgatgtagtaactattgctgaagatgtttca
ggaatggccagtcaatgcagacccgtagaagagggtggaatcggttttgattaccgttta
ggaatggcaattcctgacaagtggataaaattattaaaagaagtgagagacgaagactgg
aatatgggaaatattgttcacactttaactaacagacgatggatggaaaaaacgattgca
tacgttgaaagtcacgatcaggctttagttggggataaatcagttgccttctggttaatg
gataaagaaatgtacacacacatgtctgttttatccgagccaaatattattattgatcgt
ggcatctcattacataaaatgatcagacttataactcacggccttgggggagaagcttat
ttaaattttatgggaaatgaattcggtcatccagagtggttagattttcccagggaagga
aataataattcatatttttacgcaagacgccagtggaatttagttgatgatgatctttta
aaatataaatttttaaataattttgatgctgccatgaatcaattagaagaaaaatacggt
tggcttcacaaagattcgggttttgttagttgcaaacacgaggatgataaaataattgct
tttgaaagagcagaattgcttttcttattcaattttcatccccataaaagttttacgaat
tatcgagtcggagtcgaattaccaggaaattataaaatattattaagttcggatgattct
gattacggtggttttggacgtatcgacacgtcactgacatattccacatcgtccgagggt
tcacacggtcgtaaaaattctttgcttgtactcccgcaaagaacaatagtaccttatata
aaagcaagtaaaattaaaaattttttttttctctag

DBGET integrated database retrieval system