KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM042350Help
Entry
Phum_PHUM042350   CDS       T01223                                 

Definition
(RefSeq) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00020  Citrate cycle (TCA cycle)
phu00620  Pyruvate metabolism
phu01100  Metabolic pathways
phu01200  Carbon metabolism
Module
phu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM042350
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM042350
   00620 Pyruvate metabolism
    Phum_PHUM042350
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Phum_PHUM042350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF4179 NeA_P2 Biotin_lipoyl_2 Mito_fiss_reg
Motif
Other DBs
NCBI-GeneID: 8232591
NCBI-ProteinID: XP_002423200
VectorBase: PHUM042350
UniProt: E0VAQ6
AA seq 415 aa AA seqDB search
MESGTIISWEKKEGDKLNEGDLLAEIETDKASMGFETPEEGYLAKILVSAGTKNVPIGKL
VCIIVSDQADVDAFKNFVSTESDKTEEPDSKKSDVKESPTVTSSTSYPPPPPPPSSPLPP
SFLESSANTQNRVYSSPLAKKIASELGLSLEKLGSGSGIHGSIKAPDLQNFKSLKISQQS
VTQPAFEELTSSNAQSVLTQHFSKSKQTIPHYYLSTEINIDNTVDMNTKINKLKEKDGIS
LSLNDFIIKATALACKQVPEANSSWQDTFIRQFNNVDVNVAVITENGLLFPIVFSAETKG
LNSISTEVKELVAKAREGKLDPNDYQGGTVSIINLGMYGISNFSAIINPPQACILSVGSK
YKKVVPHSKSDKGYKISDYLSVTLSCDHRVLDGAVGAQWVSVFKKYLENPDLMLL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtggtacaataattagctgggaaaaaaaagagggtgataaattaaatgaaggg
gatcttttagcagaaattgaaacagataaagcatcgatgggatttgaaacaccagaagaa
ggatatttggcaaaaattttggtgtctgctggaactaaaaatgttccaataggaaagttg
gtttgcataatagtttccgatcaagctgatgtagatgcttttaaaaactttgtcagcact
gaatctgataaaactgaagaaccagattccaaaaaatcagatgttaaagaatctcctaca
gtgacctcttctacatcataccctcctcctcctcctcctccatcttctcctttgccacct
tcatttctggaatcttctgcaaatacacagaatcgagtgtactccagtccactggcaaaa
aaaattgcttccgagctgggattgtcactggagaaattaggttctggaagtggaatacat
ggatctattaaagctccagatttacaaaactttaaatctcttaaaatttcacaacagtct
gttacacaaccggcattcgaagaattaacttcatcaaatgctcaaagtgttcttactcaa
catttttctaagtctaaacagactattcctcattattatcttagtacagaaattaatatt
gataacactgtcgatatgaatactaaaataaataagttaaaagaaaaagacgggatttct
cttagccttaatgattttatcattaaagcgacagcattagcttgcaaacaagttccagaa
gcaaattcatcttggcaggatacttttattagacaatttaataatgtcgatgtgaatgtg
gctgttattactgaaaatggtttactgtttccgattgtatttagtgcagaaaccaaaggt
ttaaatagcataagtaccgaagtgaaagaattggtcgctaaagcaagagaaggaaaatta
gatcctaatgattatcagggaggaacagtttcaataattaatttaggaatgtatggaata
agtaatttttcagccattattaatccgccacaggcttgtatactttcagtaggttcaaaa
tacaaaaaagttgtaccccattctaaaagtgataaaggttataaaatatcggattatttg
tctgtaacgctaagttgtgatcatagagtattagatggtgcagttggagctcaatgggtg
tcggtatttaaaaaatatttagaaaatcccgatttgatgttgttgtaa

DBGET integrated database retrieval system