KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM042350Help
Entry
Phum_PHUM042350   CDS       T01223                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:phu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:phu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:phu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:phu00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 415 aa AA seqDB search
MESGTIISWEKKEGDKLNEGDLLAEIETDKASMGFETPEEGYLAKILVSAGTKNVPIGKL
VCIIVSDQADVDAFKNFVSTESDKTEEPDSKKSDVKESPTVTSSTSYPPPPPPPSSPLPP
SFLESSANTQNRVYSSPLAKKIASELGLSLEKLGSGSGIHGSIKAPDLQNFKSLKISQQS
VTQPAFEELTSSNAQSVLTQHFSKSKQTIPHYYLSTEINIDNTVDMNTKINKLKEKDGIS
LSLNDFIIKATALACKQVPEANSSWQDTFIRQFNNVDVNVAVITENGLLFPIVFSAETKG
LNSISTEVKELVAKAREGKLDPNDYQGGTVSIINLGMYGISNFSAIINPPQACILSVGSK
YKKVVPHSKSDKGYKISDYLSVTLSCDHRVLDGAVGAQWVSVFKKYLENPDLMLL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtggtacaataattagctgggaaaaaaaagagggtgataaattaaatgaaggg
gatcttttagcagaaattgaaacagataaagcatcgatgggatttgaaacaccagaagaa
ggatatttggcaaaaattttggtgtctgctggaactaaaaatgttccaataggaaagttg
gtttgcataatagtttccgatcaagctgatgtagatgcttttaaaaactttgtcagcact
gaatctgataaaactgaagaaccagattccaaaaaatcagatgttaaagaatctcctaca
gtgacctcttctacatcataccctcctcctcctcctcctccatcttctcctttgccacct
tcatttctggaatcttctgcaaatacacagaatcgagtgtactccagtccactggcaaaa
aaaattgcttccgagctgggattgtcactggagaaattaggttctggaagtggaatacat
ggatctattaaagctccagatttacaaaactttaaatctcttaaaatttcacaacagtct
gttacacaaccggcattcgaagaattaacttcatcaaatgctcaaagtgttcttactcaa
catttttctaagtctaaacagactattcctcattattatcttagtacagaaattaatatt
gataacactgtcgatatgaatactaaaataaataagttaaaagaaaaagacgggatttct
cttagccttaatgattttatcattaaagcgacagcattagcttgcaaacaagttccagaa
gcaaattcatcttggcaggatacttttattagacaatttaataatgtcgatgtgaatgtg
gctgttattactgaaaatggtttactgtttccgattgtatttagtgcagaaaccaaaggt
ttaaatagcataagtaccgaagtgaaagaattggtcgctaaagcaagagaaggaaaatta
gatcctaatgattatcagggaggaacagtttcaataattaatttaggaatgtatggaata
agtaatttttcagccattattaatccgccacaggcttgtatactttcagtaggttcaaaa
tacaaaaaagttgtaccccattctaaaagtgataaaggttataaaatatcggattatttg
tctgtaacgctaagttgtgatcatagagtattagatggtgcagttggagctcaatgggtg
tcggtatttaaaaaatatttagaaaatcccgatttgatgttgttgtaa

DBGET integrated database retrieval system