KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM042350Help
Entry
Phum_PHUM042350   CDS       T01223                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phum_PHUM042350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM042350
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM042350
   00620 Pyruvate metabolism
    Phum_PHUM042350
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Phum_PHUM042350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 415 aa AA seqDB search
MESGTIISWEKKEGDKLNEGDLLAEIETDKASMGFETPEEGYLAKILVSAGTKNVPIGKL
VCIIVSDQADVDAFKNFVSTESDKTEEPDSKKSDVKESPTVTSSTSYPPPPPPPSSPLPP
SFLESSANTQNRVYSSPLAKKIASELGLSLEKLGSGSGIHGSIKAPDLQNFKSLKISQQS
VTQPAFEELTSSNAQSVLTQHFSKSKQTIPHYYLSTEINIDNTVDMNTKINKLKEKDGIS
LSLNDFIIKATALACKQVPEANSSWQDTFIRQFNNVDVNVAVITENGLLFPIVFSAETKG
LNSISTEVKELVAKAREGKLDPNDYQGGTVSIINLGMYGISNFSAIINPPQACILSVGSK
YKKVVPHSKSDKGYKISDYLSVTLSCDHRVLDGAVGAQWVSVFKKYLENPDLMLL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtggtacaataattagctgggaaaaaaaagagggtgataaattaaatgaaggg
gatcttttagcagaaattgaaacagataaagcatcgatgggatttgaaacaccagaagaa
ggatatttggcaaaaattttggtgtctgctggaactaaaaatgttccaataggaaagttg
gtttgcataatagtttccgatcaagctgatgtagatgcttttaaaaactttgtcagcact
gaatctgataaaactgaagaaccagattccaaaaaatcagatgttaaagaatctcctaca
gtgacctcttctacatcataccctcctcctcctcctcctccatcttctcctttgccacct
tcatttctggaatcttctgcaaatacacagaatcgagtgtactccagtccactggcaaaa
aaaattgcttccgagctgggattgtcactggagaaattaggttctggaagtggaatacat
ggatctattaaagctccagatttacaaaactttaaatctcttaaaatttcacaacagtct
gttacacaaccggcattcgaagaattaacttcatcaaatgctcaaagtgttcttactcaa
catttttctaagtctaaacagactattcctcattattatcttagtacagaaattaatatt
gataacactgtcgatatgaatactaaaataaataagttaaaagaaaaagacgggatttct
cttagccttaatgattttatcattaaagcgacagcattagcttgcaaacaagttccagaa
gcaaattcatcttggcaggatacttttattagacaatttaataatgtcgatgtgaatgtg
gctgttattactgaaaatggtttactgtttccgattgtatttagtgcagaaaccaaaggt
ttaaatagcataagtaccgaagtgaaagaattggtcgctaaagcaagagaaggaaaatta
gatcctaatgattatcagggaggaacagtttcaataattaatttaggaatgtatggaata
agtaatttttcagccattattaatccgccacaggcttgtatactttcagtaggttcaaaa
tacaaaaaagttgtaccccattctaaaagtgataaaggttataaaatatcggattatttg
tctgtaacgctaagttgtgatcatagagtattagatggtgcagttggagctcaatgggtg
tcggtatttaaaaaatatttagaaaatcccgatttgatgttgttgtaa

DBGET integrated database retrieval system