KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM044390Help
Entry
Phum_PHUM044390   CDS       T01223                                 

Definition
Acyl-protein thioesterase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Phum_PHUM044390
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Phum_PHUM044390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 220 aa AA seqDB search
MSVAPVIVAASAKHTATIIFLHGLGDTGHGWSSAISSIRGPHVKVICPTAPTMPVSLNAG
FQMPSWFDLKSLDAKGPEDEEGIRKAALGVHELINNEVADGIELNRIMLGGFSQGGALAL
YSALTYPKKLAGVMALSCWLPLHKSFPASAVQGNTEIPIIQCHGDSDPIVQYKWGQMTAS
YLKSFLSNVEFKTYRGMMHSSSEEEMSDLKEFINKIMPPI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagcgccagttatagtagcggcttctgcaaaacatacagccacaataatattt
ttgcatggacttggtgatacaggacatggttggtcatctgccatctcgtcaatcagggga
cctcatgtcaaggttatatgcccaactgcaccaactatgccagtatcattaaatgctggc
tttcaaatgccgagttggtttgatttaaaatcattggatgcaaaaggacctgaagatgaa
gaaggtattagaaaggcagcgttaggagttcacgaattgataaataatgaagttgcagat
ggaatagaacttaacagaattatgttaggaggattttcacaaggaggagctttggcttta
tactcagctctgacttatccaaaaaaactggctggtgttatggctttaagctgttggctt
ccactgcataaatcttttccagcatctgccgttcaaggtaatacagaaattcccattatt
caatgtcacggagacagtgatcccattgtgcaatataaatggggccaaatgactgcatcc
tacttgaaatcgtttttaagtaatgtcgaatttaaaacatacagaggaatgatgcatagt
tcatcggaagaagaaatgagcgatttgaaagaatttattaacaaaattatgcccccaatt
taa

DBGET integrated database retrieval system