KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM051000Help
Entry
Phum_PHUM051000   CDS       T01223                                 

Definition
protein disulfide isomerase, putative (EC:5.3.4.1)
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Phum_PHUM051000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 630 aa AA seqDB search
MKFIDKVVKYALCQIIVILLAEIPCQLSAKNSQKNVISDIVDIKDFKKLLRTKNNVLTMF
VNSPKQNASVVKIFEETADYIKGQGSMVFADCSGDAKKLCKKLKINPDPIIIKHYKDGEF
HKNYDRKYTVLSMLNFMRDPTGDIPWDEDASTSGIVHIPDPPSLNKFLKKELGPVMIMFY
APWCGFCKQLKPDYAAAAEELKGHSILAAIDVNKPENVVVRKKYNITGFPTLIYFENGVK
MYNYEGENNKKGLVSFMKNPTSTPVKQTETQWSDTESEVLHLTDDTFDEVIKETESILVM
FYAPWCGHCKRLKPKYEKAAEKLKKENFKGILSALDATKETKIAKQFNVNGYPTLKYFKN
GEFEFDINLREESELVDFMKNPKKPPPPPPPEKAWAEEESEVVHLTLEEFKPFLRKKKHA
LVMFYAPSFAAVDCTSHQSVCSTYDVKGYPTIKLFQYLNKEPVEDYNGGRTQKDFTSYMK
KFVKKIQFELPKNDSKLEKIEKKTETEVDWNDIDDSDLILHLSDGNYFYSLKKYDFLLIF
YYKPGCEGCSKIKKEFSHAALMVENRKLPGKLAAFNAEKNKISVKENSFSYPSIHLFKKG
ILSGSYTGKYEALDIFNFFKTMHGKLKDEL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatagacaaagttgttaaatacgcgttatgtcaaattattgtgattttatta
gccgaaattccatgtcaattaagtgcaaaaaattctcaaaaaaatgttattagtgacata
gtagatataaaggattttaaaaaattattaaggacaaaaaataatgttttgacaatgttt
gtaaattccccgaaacaaaatgcaagtgttgttaaaatatttgaagaaactgctgattat
ataaaaggccaaggaagtatggtttttgctgattgttcaggtgatgcaaaaaaactttgt
aaaaaattaaaaattaatcctgatccaattattattaagcattacaaagatggcgaattt
cacaaaaactatgataggaaatatacagtattatcaatgttaaactttatgagagatcct
actggagatataccatgggatgaggatgcttccactagtggaatagttcatattcctgat
cctccgagtttaaataaatttttaaaaaaagagcttggtccagttatgattatgttttat
gctccatggtgtggattttgcaagcaacttaaaccagactatgctgcagcagcagaagaa
cttaaaggacattctatcttagctgctattgatgtgaacaaacctgaaaatgttgtggtt
cgaaaaaaatataacataacaggatttccgacattaatttactttgaaaatggtgtaaaa
atgtataattacgaaggcgagaataataaaaaaggtcttgtatcatttatgaaaaatcca
acttcaacccctgtaaaacaaacagaaacacaatggtctgataccgaaagtgaagtatta
catttaactgatgatacttttgatgaagttattaaagaaacggaaagcattttggtgatg
ttttacgctccatggtgtggtcattgtaaacgtttgaaacccaaatatgaaaaagctgct
gaaaaattgaaaaaggaaaatttcaaaggaatactatcagctttagatgcaactaaagaa
actaaaatagctaaacaatttaatgttaacggttatccaacattaaaatattttaaaaat
ggagaatttgaatttgacattaatctgagagaagaatcggaactagttgattttatgaaa
aatccaaaaaaaccacctcctccacccccaccagaaaaagcttgggctgaagaagaatct
gaagttgttcatttaactcttgaagaattcaaaccttttttgagaaagaaaaaacacgct
cttgttatgttttatgctccttcatttgctgcagtggattgtacttctcatcaatctgta
tgctctacctacgatgtaaaaggatatcctacaattaaactatttcaatatttaaataaa
gaaccagtagaagattacaatggcggtcgaactcaaaaagatttcacctcatatatgaaa
aaattcgttaaaaaaattcaattcgaattaccaaaaaacgacagcaaacttgaaaaaata
gagaaaaaaacggaaacggaagtcgattggaatgatatcgacgattcagatttaatttta
cacttgtccgacggtaattatttttactcattgaaaaaatatgattttttgttaattttt
tactacaaaccaggttgcgaaggttgtagtaaaattaaaaaagaattttctcacgctgct
ctgatggtcgagaacaggaaacttccgggtaaattagcggcttttaatgcggaaaaaaat
aaaatatcggtaaaggaaaattcattttcatatccatccattcatttattcaaaaaagga
atattgtcgggatcttatactggaaaatacgaagcattagatattttcaatttttttaaa
accatgcacggaaaattaaaagacgaattgtaa

DBGET integrated database retrieval system