KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM060150Help
Entry
Phum_PHUM060150   CDS       T01223                                 

Definition
7-dehydrocholesterol reductase, putative (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    Phum_PHUM060150
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     Phum_PHUM060150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MVQKGSIWYLLHYHIIPPVFIVFFIIIAQYLAIVGQGQTFTWELALSNYLGDATSWKWTS
LFVLWSIIWLKVPSKIVQGPESHFGAIPNYKTNGVQYYWATLVTFFFLQALYPNTSRTIY
MHFPKIIGVFNAYALILCIWLLIKGRLKPECPEDPEERKSLIFDFYKGVELHPHIFGEDV
KQLTNCRIGMMGWEVILCAFYMTGVEQHGFITSSLVHLLLQSVYIAKFFWWEVGYFHTLD
MMMDRAGFYLCWGTLVLIPSLFTFSAAYTVLHPPTISAWISILIGIIGLVCILLTYRVDY
EKQIFRASPNYECNIWGKTATYIPAEFKDSTGKIRKSALLTSGFWGIGRHINYTFELGTS
AAFGACLGFDFGIWNFLYFFFILILVFHRLYRDEEKCKNKYGRFWEKYCKEVPYVMIPGL
W
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaaggctcaatttggtatttacttcactatcatataattcctccagttttt
attgttttttttataataattgcccagtacttagcgattgttggacagggccaaacattt
acatgggaattggccttgagtaattatctaggggatgcaacttcgtggaaatggacttca
ttatttgtattatggtccattatctggcttaaagttccttctaaaattgtacaaggccca
gaatctcatttcggtgccattccaaattacaaaacaaatggagttcaatattattgggcc
acactagtcacctttttttttttacaagcactttatccaaatacatctagaacaatatac
atgcattttccgaaaataattggagtttttaatgcctatgcattaatattgtgcatttgg
cttttgattaagggaagactcaagccggaatgtccagaagatcctgaagaacgtaaatca
ttaatatttgacttttataaaggagtagaattacatcctcacattttcggtgaagatgtc
aaacagttaacaaattgtaggataggaatgatgggttgggaagttattctttgtgcattt
tacatgacaggggtagaacaacatggttttattacttcttcattagtacatttgcttctt
cagtctgtttacattgccaaatttttttggtgggaagtcggatactttcacacattagat
atgatgatggacagagctggattttatttgtgttggggaactcttgtccttattccctct
ttattcacattttcagctgcctacactgttcttcatcctccaacaatatctgcatggatc
tcaatattaataggtattattggattagtctgcatacttcttacttacagagtggattat
gaaaaacaaatatttagggcatcgcctaattacgaatgtaacatttgggggaaaactgca
acttacatacctgctgaatttaaagattcaactggtaaaataagaaaatccgctctttta
acgagcggtttttggggaatcggaagacatattaattacacattcgaattgggtacttcg
gctgcattcggagcatgtttaggtttcgatttcggaatatggaatttcctttattttttt
ttcatattaatattagtttttcacagactgtatcgtgacgaggaaaaatgtaaaaataaa
tatggaagattttgggaaaaatattgcaaagaagtgccctacgtaatgatacccgggttg
tggtaa

DBGET integrated database retrieval system