KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM065530Help
Entry
Phum_PHUM065530   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.11.23)
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 358 aa AA seqDB search
MTGSANFESCVELTKQAHNYEDLALIGNGAYGTVYKAKNKTNGHIVAMKKIRVHLCEDGG
LPPSTLREIAMLKQVDQYEHPNIVRLLDVCYGPRLEEYLVLFIVFEHMEQDLSQFISNCP
APGIGVNRIKDLTFQLLSGVDFLHTHRIIHRDLKPQNILVSCDGQYLKLADFGLAKVYEF
ESSLTSVVATLWYRPPEVLLRDTYATPLDVWSCGCIMAELYRRTPLFPGVTEGDQLGKIF
DIIGTPSESEWPQNTSLLRSSFPHSPGIDLEAVVPEICGHGKDLLQRMLRFEQHKRITAC
EALNHPYFKDFGYVPLEIGTSLNQSTSSASNASTPVSVNSCKCCSCDDSRTSTESPDK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgggatctgcaaatttcgaatcatgcgtggagttaacgaaacaagcccacaattac
gaagatttggccctaattggaaacggagcgtacggaaccgtttacaaagcgaaaaacaaa
acaaacggtcacatagttgcgatgaaaaaaattcgagttcacttatgcgaagatggtgga
cttccgccttctacactacgagaaatagccatgttgaagcaagttgaccaatacgaacat
ccaaatatagtcagattattagatgtttgttacgggccaagactggaagagtatttagtt
ttgttcattgttttcgaacacatggaacaagatttatcacaatttataagtaattgtccg
gcgccagggatcggtgttaatagaattaaggatttaacgtttcaacttttatcgggagtc
gattttcttcacacgcataggataatacatagagatttaaaaccacaaaatatattggtg
agctgcgacggacagtaccttaaattggccgatttcggtttggctaaagtttacgaattc
gaatcgagtttgacaagcgttgttgccactttgtggtatagaccgccggaagtacttcta
agagacacatatgccacgcctttggatgtttggtcgtgcggttgcataatggccgaacta
tacaggagaacgccattgtttcccggagttactgagggtgatcaattaggaaaaatattc
gacattatcggaacgccgagcgaaagcgaatggccacaaaatacgtctctgttaagatcg
tcttttccgcacagtcccggaatcgatttggaagccgtggtaccagaaatatgcgggcac
ggcaaggatttgcttcaacggatgctgaggttcgaacagcacaaacgtataacggcttgc
gaagcgttaaatcatccgtactttaaagatttcggttacgtaccattagaaataggaact
agtctcaaccaaagcacatcgtcggcgagcaacgcatcgacacccgtttcagttaacagt
tgtaaatgttgcagctgcgacgattcgagaacatcaacggaaagtccagacaaataa

DBGET integrated database retrieval system