KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM066550Help
Entry
Phum_PHUM066550   CDS       T01223                                 

Definition
Uroporphyrinogen-III synthase, putative (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM066550
Enzymes [BR:phu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Phum_PHUM066550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 311 aa AA seqDB search
MTATDVFYRYGVNRLGVYLLPIIISTVILKLRKISESKMDSLPFIIGSIGIKMNDYECKQ
IVLFKSISETENVENDVYYETFLSKGFNTILIPVLDFDFINIEELTIKLNNHKNYSGIIF
TSPRSVLGLKLSLDNNDNKEIINQWKNHTNYVIGEKTEKLAKDLGFITRGKETGNGDALA
ELICKKSFEKPFLYLIGSLTQKNFKIKLEKNNIKVDDLVIYKTKPHSDLEENILKLKLEI
NDKPAYFIYFSPSGVNYTIPILKKLNYNFEFIKFVAIGPTTEKQLIEFGFKVFKTSLEPN
PKYLLDSILEN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaactgatgtcttctacaggtatggcgtcaacagactgggcgtctatcttcta
ccaataattatatctacagtgatattaaaattaaggaaaatctcagaatcaaaaatggat
tccctacctttcattattggtagtatcggaattaaaatgaatgattatgaatgtaaacaa
atagttttatttaagtcgatatcagaaacagaaaatgttgaaaatgatgtttattacgaa
acttttttgtcaaaaggatttaacacaatcctaatacctgttttagattttgattttatt
aatattgaagaattgacaataaaattaaataatcacaaaaattattcaggaatcatattt
acgagtccaaggagtgttttgggattgaaattatcacttgataataacgataataaagaa
ataattaaccagtggaaaaatcatacaaattatgtaataggagaaaaaacagaaaaatta
gctaaagatttaggttttataactcgaggaaaagaaactgggaatggtgatgcattagca
gaattaatatgcaaaaaatcatttgaaaaaccatttttatatttgatcggatcactgaca
caaaaaaattttaaaatcaaactagaaaaaaataatattaaagtagatgatttagtaatt
tacaaaaccaaaccacattcagatcttgaagaaaacatattaaaattaaaattagaaatt
aatgataagcctgcatatttcatatattttagcccatctggtgttaattatacaattcca
atattaaaaaaattaaactataattttgaattcattaagtttgtcgcaatcggtccgaca
acagaaaaacaattaatcgaatttggatttaaagtttttaaaacgtctctcgaaccgaat
cctaaatatttactcgattcaattttagaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system