KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM067370Help
Entry
Phum_PHUM067370   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:phu04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 805 aa AA seqDB search
MTDPNLSKNVSELAGVGSSGFSNQQPDESQQQQPPDQVNQKQSNLLRIQQRKQQVYNWPN
HKKLLKLAVYSACQAEECLCTGWKTTPAPTQTLASNDTPCRNCTHILEQHISHLRMVPDP
EINRLLGMVVDVENIYMSMQKEEDPDTKRVYFYLFKLLRKCIVTMTKPTIEGPLGQPPFE
RPSIAKAVTNFVLHKFGHLAQREWQTMYELAKMFLHCLNNWNYESPSIRRNVAAPEATSA
YKINYTRWLVFCHVPAFCDSLPHFDTTVVFGRKLLRAVYKSVCRQLIDKCHAERDRMQTE
NRILILTHFPKFLSLLEEEIYAPNSPIWDPEFRQVPPAHIQAVFDAKAAAAAAGRKVGEF
EKLTAPPNEKDNFTTFNVTPGVGRKGTSQKSDGEKRSGESTSGRPEKKRKQEEYVDDVSE
NTIAEILATIEDGKGNAGPQAVFPENAPRDEAAKQEEARGIIQFQVVGNSLTQSVSKQTM
LWLIGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKGGRAIGGICFRTFASQGFVEIV
FCAVTSNEQVKGYGTHLMNHLKDYFINHNILHFLTFADEFAIGYFKKQGFSKDIKLNRNI
YQGYIKYYERATLMHCQLNPTIVYTEFTAIIRKQKEIVKKIIEQRNQEVQKVHQGLTCFK
EGVRGIPIEAIPGIRETGWKPAARTTRISRVTSEPNDPDTLCSALTGVYNAVKNQSHAWP
FLKPVDKNEVPDYYHHIKYPMDLKTMGERLRSGYYHSRRLFIADMTRVFTNCRLYNSPDT
EYYRCANNLEKYFQTKMKEIGLWDK
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgacagatccaaacttgtcaaaaaatgtcagcgaacttgctggagttggtagctcaggt
tttagtaatcaacaacctgatgaaagccaacaacagcaacctcctgaccaagtcaatcag
aagcaaagcaatttgcttaggattcaacaaagaaaacaacaagtatataattggcccaat
cataaaaaattattgaaattagctgtatactctgcttgtcaggctgaagaatgcctgtgt
acaggttggaaaactactccagctcctactcaaactttagccagcaatgatacaccttgt
aggaattgcacccatattttggaacaacacatatctcatcttcgaatggttcctgatcca
gaaattaataggctcctcggaatggttgtcgatgttgaaaacatttacatgtcgatgcaa
aaagaagaggatcctgatacaaaaagagtttatttttatttatttaaattacttaggaaa
tgtatagtcacaatgacaaaaccaaccatagagggtcctcttggccagccaccatttgaa
cgaccaagtatagccaaagccgtcacaaattttgttttgcacaaatttggtcacttggcc
caaagggaatggcaaacaatgtatgagttagctaaaatgtttcttcactgtttaaataat
tggaattacgaaagtcccagcattagaaggaatgtcgcagctcctgaagcaacttctgca
tataaaattaattacactagatggctagttttttgccatgttcctgctttttgtgattcc
ttgcctcatttcgataccacagtagtatttggcagaaaattattaagagctgtttataaa
tctgtttgtcgtcagttaattgataaatgtcatgctgaaagagacagaatgcaaacagaa
aatagaattctcatccttactcattttcctaagtttttatcattattggaagaagaaatt
tatgctcccaattcccctatatgggatcctgagtttaggcaagttccacctgcacacata
caagctgtatttgatgcgaaagctgcagcagcagcagcaggacgaaaagtaggagagttt
gaaaaactaactgctcctcctaatgaaaaagataattttactacttttaacgtaacccct
ggagtcggtagaaaaggaacatctcaaaaatctgatggtgaaaaaagatcaggagaatcg
acatctggccgaccagaaaagaaacgaaaacaagaagaatatgttgatgacgtttcggaa
aataccattgccgaaattttggctaccatagaagatggtaaaggaaacgctggcccccag
gctgtttttccggaaaatgcaccgagagacgaagcggccaaacaagaagaagctcgagga
ataatacaatttcaagttgttggaaattcattgacacaatccgtttcgaaacaaacaatg
ctttggcttatcggtcttcaaaatgttttttctcatcagttaccacgaatgccgaaggaa
tatatcacaagattggtattcgacccaaaacacaaaactttggctcttatcaaaggaggg
agagcaatcggaggaatatgtttcagaacttttgcttctcagggttttgtcgaaatagta
ttttgtgccgttacgtcgaacgaacaggtcaaaggttacggaactcatttaatgaatcat
ttaaaagattattttataaatcacaacattttgcattttcttacatttgcagacgaattt
gccatcggttattttaaaaagcagggtttttccaaagacattaaattaaatagaaacata
tatcaaggttatataaaatattacgaaagagcaaccctcatgcactgccagttgaatccg
accattgtttacacggagtttactgcgataataagaaaacagaaggaaatcgttaaaaaa
attatcgaacaaagaaatcaggaggttcaaaaggttcatcaaggtttgacttgttttaaa
gaaggagtgcgtggcattccaatcgaagccataccgggaatcagagaaaccggatggaaa
cctgctgccaggacaacgagaatcagtagagttacttcagaaccaaacgatccggatact
ctttgcagtgcacttaccggagtgtacaacgcagtcaaaaatcaaagtcacgcatggcca
tttttaaaacccgtcgataaaaatgaagtacccgattattatcatcacataaaatatccc
atggatttgaaaacgatgggagaaagattgaggagcgggtattatcattcgagaagatta
ttcattgccgacatgacgagagtttttacaaattgcagattgtataattcaccagatact
gagtattataggtgtgcaaataatttagaaaaatattttcaaacgaaaatgaaagaaata
ggactctgggacaaataa

DBGET integrated database retrieval system