KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM076540Help
Entry
Phum_PHUM076540   CDS       T01223                                 

Definition
ubiquitin specific protease 9/faf, putative (EC:3.1.2.15)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Phum_PHUM076540
Peptidases [BR:phu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Phum_PHUM076540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2583 aa AA seqDB search
MTISTRGVNEPTECNDQVTNTEVVEEIIEDEPISEIGEPDFPHDKLAELDTKISSPRWVV
PVLPDQELECLLQASIDLCKKGIDTRSEACQRFFREGLTISFTKILTDDAVNSWKPNIQL
YIYQNCQRLVELCVIKLNQDWFPLLDLLAMLFNPNCKFHVFNNSRPPESIPPGMHISDEE
VYCRPVPDSRLPRGWLVDLINKFGNLGGFKILLERFQTGENLSVAVMYSLIRPFGLCYEL
LTVNTIVKYFMPVIEIILQVLDGLTDEELKKEAKNELKNDSISCIIKAAKCLVSRVPGKE
ETSKDLEIFRLRMILRLLQISSFNGKMNALNEVNKVIASVAYYPHRHTPVEEDEWLTPER
MAKWIKDNQVLEIVLRDSLHQPQYVEKLEKILRFIIKERCLTLSDLDAIWAAQAGKHEAI
VKNVHDLLAKLAWDFSPEQLDHLFECFQSSWTNANKKQREKLLELIRHLAEDDKDGVMAH
KVLTLFWNLAHSDDVPTEIMDQALAAHVKILDYSCSQKKDAQKTSWLAKCVEELKSGDKW
VLPALKQIREICCLYEQSPNLNHSQRSQHIYYRQQIIDRLQNNHSLVILVSDSLENYIEK
VKKLVSHHPELDSQNFCIDGRYCHELQVQERLNFLRFLLKDGRLWLCDSQAKQIWKCLAE
DGVFPSDREACFKWFSKLMGEEPDLDPTKNREFFEDNILQLDPTLLTESGMKCFERFFKT
VNKKEGKLIQKHRSIVMEDPDLIGMDYLWRVITNSGEEIANRAIEIMREVCTNLGSQLTS
NIYEFHETYIAECLDRLRTHYDNVTLLMKEDIMKNRLKDEAVRMCRVMKVLHEYISECDN
TFVNERKILPLHRAYRGKCIILTIRFTHPQRALDDMDIYTHTNETLASFRRSILRRIKAG
TSVKVELVVNGDSREPIILADDRKLLSQLPIRDKMIITAKLCQTNINAASSPETSSDSST
SSPQHPYDGPNLEAENVLPGVLMSRKSIYAKFLFQLSDLGCELHYPPLRDGARNLLQLVP
PDQSTVEKLKQLFEIYPNSEHSQDNNITVENIFFDNSCTKVLYNVEVMYSLLMPASDPMS
AEAFEFQYNFVKSGHAPIVLEMLTKNNFLPNADVATKRSAYVTILKMCKLLLTVIGHVLG
RVPFDDSSQPHDQGGSDGNPINSHSPTSHASPSGLLRTLNSVFNQGVELMIRNVAKKLAA
YIDEQPQIIMESKAGQMFLSARSWELPDTNTVRAVMRLAWAASTGSLSCLHSPHEMHNSH
LLGKIPDPDDVVLCREALQVLTVSLVLNYKVMDNFIKDPLWHTFIIDLLLLAKNRVVRSS
ASDQFLLILYDSAQQPLLFCISLLFSQLNTTVIANCKNSSEYFLLLCRLINYALMTDCPV
PNAEILLDNEIAWLKKIKENVKETGETQVEEAVLEGHLNIAKELMGFLSPEKKYLLGSSE
KKGLCFIKEILEDFIFPASKLMLQFLKTGDLVCENAIPVCNTPCTENAAFDLLVALCMGC
VPNMKLLVHMLTEMFYSEREKPLTEWDYMPPIGPRPPKGFCGLKNAGATCYMNSVLQQLY
MVESIRVGLLAAEGAATDLNEDFSGEERLETENTDVEHIDGDSNDDKGGVDESRKEYNIG
ILKQVQAIFGHLAYSELQYYVPRGLWKHFKLQGKPVNLREQQDAVEFYLRLVESLDEALK
ALGQEQIMSKVLVGSFSDQKICKGCPHRYFKEELFSVINVDIRNHSSLLDSLEQYVKGEL
LEGADAYHCDKCNKKVVTVKRPCIKKLPPVLAFQLKRFDYDYERECAIKFNDYFEFPRDL
DMDPYTVSGLAKLEGELIDCDYDELSKEMCTKYQLTGIVVHSGQASGGHYYSYILHRQSD
GTSKWYKFDDGDVSECRMEEDEEMKSQCFGGDYTGEVFDHIMKRLSYRKQKRWWNAYMLY
YTRLDVRSSNTSFCEYNNNNINVYLNYNYIIYLLIVILLFLADLKKNTMKMPLVIEQGVR
RQNIVFMHNRNQFSAEYFQFIKKIVSCNSSLLRLHNDKLTLDSEELSMLSVQLASRFLFH
TGFHTKKSLRGAAYDWYEVLSQHLRHSASVRLWFAKEIIFQHPYRLSEYLLNSPSTEVRA
AFMKIILFLAHFSLHDGPCDSLIYNGKSKNIDSNFSLSDHLLHALILLLDKDIADHGKHS
VHYFTLFQMYAQLGLEEKAQLLRLNVAKIFINVALEEGPIPAIKSQYFDCTKLHQVVSML
VRCCDLSTSTQNSNASVQPLPNPYCDPQCSSSYLMPIQPDVAELLFGKVGYAKKLIDNPS
PSEDIVKLIQFCTWENPIFSKNLLSETLRQIACTIYQDLKHYLDWLLHLLLIEDSWQTHR
IHNALQGMADSDAKEGLFEIVIKSKTHYQKKAYQCIKYMTTLFSKCRAAHVLLTSTEEIR
RKWLHCNECFPFPANVQYSCDNWLLSTKTNDSANGYFPERSNSARKLLVHSVELCPQDEP
EVEEVSEEGEGLQSLEWKGLVVSKYFGNQSKDRRKNRVQIRKMDETSEDGIASIVEMQQR
SFKPIRRENNQRRSDPNAADSGDEEFAWFCGMNKRMSSPSDLPQSLSRHSLTDVALVQET
QVS
NT seq 7752 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctctactcgtggagtaaatgagcctacagaatgtaatgaccaagtaacaaat
actgaagtagtagaagaaattattgaagatgaacctatatcagaaattggagaacccgat
tttccacatgacaaacttgcagaacttgatactaagatttcttctcccagatgggtagtt
ccagttcttcctgatcaggagcttgaatgtcttttgcaagcttccatagacctttgtaaa
aaaggaattgataccaggagtgaagcttgccaaagattttttcgagaaggtcttactatt
tcatttacaaaaattctgactgatgatgcagttaactcatggaaacccaacattcaatta
tatatatatcaaaactgtcagcgacttgtggaattatgtgtaattaaattaaatcaagac
tggtttccactattagatctactggctatgttatttaatcctaactgcaaatttcacgtt
tttaataattctcgaccaccagaaagtattcctccaggaatgcatatttctgacgaagaa
gtttactgtcgtccagtaccagacagtcgattaccacgtggatggttagtcgatcttata
aacaaatttggtaatctcggaggatttaaaattcttttggaaagatttcaaacaggagaa
aatttaagtgtagccgttatgtattctttaataagacctttcgggttatgttacgaattg
ctaactgttaatactattgtaaaatattttatgccagttatagaaatcatacttcaagtt
cttgatggcttaacagatgaagaactaaaaaaggaagccaaaaacgaactgaaaaatgat
tcaatttcttgcataattaaagcagctaaatgtcttgtttctcgggtgcctggaaaagag
gaaacctccaaagatttagaaatttttagacttcgtatgattctcaggttacttcagatc
tcgtcatttaatgggaaaatgaatgctttaaatgaagtgaacaaagttatagccagcgta
gcatattatcctcacagacacactcctgtagaggaggatgaatggttgacacctgaaaga
atggcgaaatggattaaagacaatcaggttcttgaaatagtattaagggattcgttgcac
caacctcaatatgttgaaaaattagaaaaaatattacggtttattattaaagagagatgt
ttgactttaagcgatttagacgcaatttgggctgcacaggctggaaaacatgaagcaatc
gttaaaaatgtacacgatttgctagccaaacttgcatgggatttttctcctgagcaatta
gatcatttattcgaatgttttcagtctagttggaccaatgcaaacaaaaaacaaagagaa
aaattattagaacttattcgtcatttagccgaagatgataaagatggtgttatggctcat
aaagttttaactcttttttggaatttggcacattcggatgatgttcctactgaaattatg
gaccaagccctcgcagctcatgttaaaattttagactatagttgttctcagaaaaaagat
gctcaaaaaacttcttggttggcaaaatgtgttgaagaattaaaaagtggtgataagtgg
gttttgccagccttaaaacaaattcgagaaatatgttgtttatatgaacaatctcctaac
cttaatcatagccaaagatcacaacacatttattacaggcaacaaataatagaccgatta
caaaacaatcactctttagtcatactagtttctgacagtttagaaaattatattgaaaaa
gttaaaaaactagtcagtcatcatcctgaattggattcacaaaatttttgtatcgatgga
cgatattgccatgagttacaagtacaagaacgcctaaattttttaagatttttacttaag
gacggcagactttggttgtgcgatagtcaagccaagcaaatttggaaatgcctagcagaa
gatggagtttttccttctgatagggaagcttgttttaaatggtttagtaaactaatgggt
gaagagccagatcttgaccctactaaaaatagagagttttttgaagataatattctacag
ttggatcccacattattgactgaaagtggaatgaaatgttttgaaagattttttaaaact
gtaaacaaaaaggagggaaaactgattcaaaaacacagatccattgtgatggaagatcct
gatttaatcggaatggattatctttggagagttataactaattcaggggaagaaattgca
aatcgggctattgaaataatgagagaagtttgtactaatttaggttctcagttaaccagt
aatatatatgaatttcacgaaacgtatatagccgagtgtttagatcgattaagaactcat
tacgataatgtgactcttttgatgaaagaagacataatgaaaaacagactgaaagatgaa
gccgtgagaatgtgtcgtgtcatgaaagttttacacgaatatattagcgaatgcgataat
acatttgtaaacgaaagaaaaattttaccattacatagggcttacagaggaaaatgtata
attttaactattaggtttactcatcctcagcgggctttggatgatatggatatttatact
cacacaaatgaaaccctggcatcgtttagaagaagtattcttcgcagaattaaagcggga
acatctgtaaaggttgaacttgtagttaacggagattctcgagaacctattatcctagca
gatgatcgaaaattgttgtctcaattacctattcgtgataaaatgataatcacggctaaa
ttatgtcagacaaatataaacgctgcttctagtccggaaacttcttctgatagttctacc
agttcacctcagcatccatatgatgggcctaatttggaagctgaaaatgtcttacctggc
gtgctcatgtctagaaaaagtatttatgccaagtttctatttcaactctcagatttagga
tgcgaattacattatcctcctttgcgagatggtgcaagaaatcttttacagctagttcct
cctgatcagtctacggtagaaaaattgaaacagttatttgaaatttatcctaacagtgaa
cacagtcaagataataatattacagtagaaaatatttttttcgataattcttgcacaaag
gttttatacaatgttgaagtcatgtactcattattgatgcctgcttcagatccaatgagt
gctgaagcatttgaatttcaatacaattttgtaaaaagtggccatgctccaattgttctt
gaaatgcttactaaaaataattttctaccaaatgcggatgttgctaccaaaagatctgcg
tatgttaccattttaaaaatgtgcaaattacttttaacggtcattggccacgtattagga
cgagttccttttgatgattcatcacaaccacacgatcaaggaggttctgatggtaatccg
attaattcgcattctccaactagtcatgcttctccttctggtcttcttcgtacccttaat
tctgtttttaatcagggtgtagagcttatgattagaaatgttgcaaaaaaacttgctgct
tatattgatgagcaacctcaaataataatggaaagtaaagcgggtcaaatgtttctaagt
gcaagatcctgggaacttcctgatacaaatacagttcgagcagtcatgagattagcctgg
gcagctagcactggatcactttcatgtctccatagtcctcacgaaatgcacaattctcac
cttttaggcaaaattccagatccggatgatgtcgtgttgtgccgtgaagctcttcaagtt
ctcaccgtttctctcgtgttgaattataaagtgatggataattttattaaggatccgctg
tggcatacgtttattatagatctgttgttattagccaagaatagggttgtccgaagttct
gcttcagatcaatttttattgattttatacgatagtgcacaacaaccacttttgttttgt
atttcattgctcttctctcagcttaacactaccgtcatagcaaattgtaaaaattcttcg
gaatattttttgcttttgtgcagattaattaattatgctttaatgacagattgccccgta
ccaaacgccgaaatactattagataatgaaatagcttggctaaaaaaaataaaggaaaac
gttaaagaaacaggggaaactcaagtagaagaagctgtactagaagggcatttaaacatt
gccaaagaattgatgggattcttgtctccagaaaaaaaatatttgcttggcagcagtgaa
aagaaaggactatgtttcattaaagaaatattagaggattttatttttcccgcaagtaaa
cttatgcttcagtttttaaaaactggtgatttggtttgtgaaaatgcaataccagtgtgt
aatactccgtgtacagaaaatgctgcctttgatttattagttgcactttgtatgggttgt
gtaccaaatatgaagttattagttcatatgcttactgaaatgttttattccgaacgtgaa
aaacctctgacagaatgggattatatgccgcctataggaccgagacccccaaaaggtttt
tgtggtttaaaaaatgctggagccacatgttatatgaattcggttcttcagcaattgtac
atggttgaaagtattcgtgttgggcttttagccgcagaaggagcagcaaccgatttaaat
gaggatttcagcggggaagaaaggttggaaactgagaatacggacgttgaacatatagat
ggggattcgaatgatgataaaggaggagtggacgaatctagaaaagaatacaatattgga
atattaaaacaagttcaggctattttcggtcatcttgcttatagtgaacttcagtattac
gtgccgagaggactatggaaacattttaaattgcaagggaaacctgtaaatttacgtgaa
caacaagatgccgttgagttttaccttagattggtagaaagcttggatgaagctttaaaa
gctttaggacaagagcaaattatgagtaaagttttagtcggatcgttttctgatcaaaaa
atttgtaaaggatgtccacataggtacttcaaggaagaacttttctccgttatcaatgta
gacattagaaatcattcatcattattagattcacttgaacaatatgttaaaggtgaatta
ttagaaggagcggatgcttatcactgtgataaatgtaataaaaaggtggttacggtaaaa
agaccgtgtataaaaaaattaccccccgttttagcttttcaactgaaaagatttgattat
gattatgaaagagaatgtgccattaaatttaatgattattttgagtttcctcgagacttg
gacatggatccctacacagtgtctggattagctaaacttgaaggtgaattaatagactgt
gattacgatgaactatctaaagaaatgtgcacaaaatatcaattaaccggtattgttgtg
cacagtggtcaggctagtggtggtcattattattcctacattttgcataggcaatccgac
ggaacttctaaatggtacaaatttgatgacggagatgtgagtgaatgtagaatggaagaa
gacgaagaaatgaaaagtcagtgttttggtggagattatacaggtgaagtttttgatcac
attatgaaaagattgagttaccgaaaacagaaaaggtggtggaacgcctacatgttatat
tacacgagattagacgtaaggtctagcaacacatcattttgtgagtataataataataat
atcaatgtttacttaaattataattatattatttatttattaattgttatattattattt
ttagcggatttgaaaaagaatacaatgaaaatgcctcttgtaatagaacaaggtgttcgt
cgccaaaatattgtatttatgcataatagaaatcaattttctgccgaatattttcagttt
ataaaaaaaatagtttcttgcaacagttcattattgagacttcataatgataaattgacg
ttagattcagaagaactatctatgttaagtgtacagttggcatcaaggtttttatttcat
actggatttcatacgaaaaaaagcttgagaggagcggcttatgattggtacgaagtgttg
tcccaacatcttcggcattcagcttcggtcaggctttggttcgctaaggaaatcatattt
caacatccttatagattatccgagtatttgttgaattcaccgagcacagaagttcgagct
gcttttatgaaaataatactttttctggctcatttttctcttcacgacggtccttgtgat
tctctaatttataacggaaagagtaaaaatattgattcaaactttagtttaagtgaccat
ttactacatgctcttatattattattagataaagatattgcagaccacggaaaacattct
gtgcattattttactttatttcaaatgtatgctcaattgggtcttgaggaaaaagctcaa
ttacttcgacttaacgtagctaagatatttataaatgtggccttagaagaaggtcctata
cccgccattaaatctcaatattttgattgtacgaaacttcatcaagtagtatcaatgtta
gttaggtgttgtgatttaagcacgagtactcaaaattcaaatgcttctgtacaacccctt
cccaatccgtattgtgatccgcagtgctcttcatcttatttaatgcctatacaaccagat
gttgctgaacttttattcggtaaagtcggatacgcaaaaaaattaattgataatcctagt
ccatcagaagatatagtaaaattgatacaattttgcacgtgggaaaatccaattttttct
aaaaatcttttaagtgaaacccttcgacaaattgcttgtaccatatatcaggatttgaaa
cattatttagattggctccttcatttattattaatcgaagactcttggcaaacgcacaga
attcacaacgcacttcaaggtatggccgattcagatgcaaaagaaggcttgtttgaaatc
gttataaaatcaaaaactcactatcaaaaaaaggcttatcagtgtattaaatacatgacg
acattattctccaagtgcagagccgctcacgtgttgttaacgagtaccgaagaaatacga
cgtaaatggttacactgtaacgagtgttttccgtttccggctaacgttcaatacagttgc
gataattggttattgtcaactaaaaccaatgactctgctaacgggtatttccccgaaaga
tcgaatagtgctagaaaacttttagtgcactctgtcgaactttgcccccaagatgaaccc
gaagtcgaagaagtttcggaagagggtgaagggttgcaatctttggaatggaagggcctt
gtagtttctaagtatttcggtaatcagtccaaagataggcgtaaaaacagagttcaaatt
agaaaaatggacgaaacttccgaagatggcatcgcatccatcgtggaaatgcaacagcgt
tcatttaaacccattagaagagaaaataatcagcgaagatccgatccgaatgcagccgat
tcgggagatgaagaatttgcttggttttgcggtatgaataaacgtatgtcgagtccaagc
gatttgcctcagtcgctatcgcggcactctttaaccgacgttgcactcgtacaagaaact
caggtatcataa

DBGET integrated database retrieval system