KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM076810Help
Entry
Phum_PHUM076810   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM076810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2862 aa AA seqDB search
MSSKDSLRLSHVGLVARSPEGHAAKGMAIKGNEDLWVEIQANTFKNWVNEHLKRVNMEVI
DFTSDFIDGTRLCALVELLQKRKIGPWNKKPTNQHHFFENVTMALNAIAEDEVKLVNIGN
VDIVNGNLKLILGLIWSLIVRYQIGRSKFPPKKLMLAWLKAKCNIQNFTTDWNSGQYLSA
LLEYCKPGLFPHWKRIDKTDSVNNCRRAMEIARKEFNIPVVLEPEYLASPFLDELSGMTY
LSYFMKEYSPGYYATLKWVQNQIPEKNVKNFTTDWNDGNVLCSLVKSLGGSVPGYKSLNF
DPLFWEQNLMQGIRGGEKLGVEPILKAKDMADKNVEHLGVMAYAANFQWIPTRTAPNQRI
KVSSEKHSCRVNENVSFSMEFMDEDVDGREIKAFVISPIGMTDCRLNLGQFGGKGNFVPS
VVGMHQLNVSYEGENVIGSPLYVRVAPPLSNIEFPGIEPCAIGSIVEVLVNSYGGSASNV
DVTAWSPTDRSLPCPVQSKDGIYTAKFQPDEVGEWSIAVTHKGEHIQGGPFPCFVFDPNG
IKLLNTDGALPNLPFTFLLDASETGGLGDIKIDLVHEKKSVPHTFEKIAENLYKINFVPK
HNGKYRVYVYFCGMDVRGSPFVIRVGTKKRNSTLPKTTVKDVLSKPVISESPTFVNHMRT
VSPILDNSSPLYSPQFVKQTQYLTKNLKNNSNIRDNSDFVSVNTVQVSKEPNPPIKVNLI
NGEPSRKGILKTEKFITNDVLSSDSFKKELMQRIKSPKSPSFTTNSTVLSSTPIENQTLK
SSSSYNKFERIQSPIDRSLSPLNKVTITSKVYKSTERSSSPMIKNSSPVIFNNQRDFNDM
EENTDKFSNIKSKFFHYYYLRKIITSKSNSSSYYNSLNRISKQETSKDYVDASHPRFLEK
DNISFKNSIKVNSVDKPSPLMSSPSPGLARGSAQGDSLKLVPINVQSEIDLDLGPDIVPS
DVNVIIIAPSRKDVPVRIIKSVFKKNLSAIFTTSEVGEHYVDVRVKNQRISGSPFRTHAY
NARAIKVGNIPNGKIGESVEFEIDGSEAGSGNLEILVNGGHVTSFVRNLGQQRFLASFVP
HQALVHMIEIKFNGEYVPGSPWRVTVSSGKAMAVLGETVKLVPAGSTAEFLISAPGSSKG
NFDVQVISPSKKQIDSRIVEEKPSEFRIEFTPTEVGSHFVEVKINGVKLAGGPLIAKVYN
SSMIRVTDVASGVVGQPCQFKVDASQAGEGQLEISINEGQVPNHVQVVGGGRCLISFTPE
QPKPHYISIKFNGETIFGCPFVCSVSDNNKVTLSLRNLELIPVNQVARFHMTVDDNNNAE
LAVSVRGPTGELPVKVSGNIDSGFVAEFTPREVGAHSLTVEYNGQPVGGTPFTSKAYDAK
GVYVGPLPKGQVGKTLEFLVDASQAGEGNLEITISSRGHNIPTQVLPQGNARFSVSFLPI
EASDHVISINFNKESVPGSPFIAEVQGDSPHNITVSGSSLSAAPVGKNSYFTLSNVAGGV
EDIEVNVEGPNGQSVPAQMKENGGGIHTVEFSPKVVGEHKIMINYRGVAIAGSPFKCKVY
DCKAIKVKNVDKGVVGKPVTFLGNQAGPGNLEVTVNGGRVPTSAQAQGSQTYAISFTPRE
AIPHTVELKFNSEHLPGSPFVCQATDAAKIVMPSEGMEKVGVGRVASFVIEADSNMGVLD
IQVLSPTRKNVPVNLNNLSYNKYEASFTPEDVGDHSVEVKINDNHVDGSPFLVKAYDANR
VKVADVNSGIVGKPVFFSINASQAGAGNLEIIVSVNGRNVPNYVQSEGNAKFRVNFKPQE
AAPHNLSVRFNGEPVPGSPFVCKVLGSNQIIVSGPALKMTPIGQETCLYIDPQVSNSGIN
AQCQVSIQSPSGKMLPVVLTKLDGKYSASFTPDEVGRHSIDAILDKNLVKGSPFACNVYD
VARVKISGLGPTKVQKPVTFRVDASEAGEGTLELVVSTERSTVKAEVVACARGLYDVTFV
PHEAIVHFVNISFNEEDIPEGPKENVVGQKTFFDVQVFGANGHIDMEILDEKGSCVPCKV
QRITNGKYKAIFTPTVTGVHQITVFNNEQLINKQPFVIEVFDPAAVHVLDLEPVDSREAG
PGTLTVSVRAAGSPIKHSVKDLSEGLHEITFHPTIAIPHKIDIKYNGLHIRGCPLELPIK
NPAVGQDVMATGSGLYEAKVGKSSSFVIETLGNPSKDFDIVITGPNSSAVPVRCYQQKDG
NFDPFDWFLGLYKIEVSHGTRPVRGSPYICHVHDSSKVKIQDVIKPVSLNSPATLKLMRK
GAGFAELDVAVTSPLGQDLPIQIKSGPDRESDLIEFTPTLPGNYKFKITYGGDEIPGSPL
LLTCEDSEPVKAYGDGINYGQVDNLVTFRVNASSKPVIKIDGPDTSPSPKIEMESSGVYV
VSYVPREIGVFDIQVIVGDREILGSPFHPKIVDARKVRVIGGWESICDSSGKLELQVHQT
KKISLDVSEAGPGSLTAEFRGPDGEIIPAAVGPITSNKVKVLLTPRDSGEHSLHLYFGGV
PVPGTPLKADGSTNGGPVRVVLTGKGLVSAKCHQEAEFTIDGSQAGPGVPEASLSGSKGD
VPINLESIGESIFRGSYTPSLPGTYFLNVMWADRQVKGCPLKVNVTASADASQVACSGDG
LRVGTVGKEIRSFIDTRRAGPGELTAHCVGPHKVAYCELYDHGDGTFTLNVKPQESGRHV
LTIKYGGDHVPGSPYTLRVAGAPDPSKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLT
VRVRGPKGAFRVEMQRESQKDRTILCKFHPTEPGDYRVEVKWAGELVPGSPFNVMIFDTQ
EELTRFLQGQQSPGSDVYGSVSYGHVPGSLGRQSWRGSQPTL
NT seq 8589 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaaagattcacttagattatctcatgttggacttgtggcaaggagcccagaa
ggtcatgcagctaaaggaatggcaattaagggaaacgaagacctttgggttgaaatccag
gctaatacatttaaaaattgggttaatgaacatttaaaaagagtgaatatggaagtaata
gactttacatctgacttcattgatggcactcgactttgcgctttagttgaacttttgcaa
aaaagaaaaattgggccatggaataaaaaaccaacaaatcaacatcatttttttgaaaat
gtcacaatggctttgaatgcaatagctgaagatgaagtaaaattagttaatattggtaat
gtagacattgtaaatggcaacttaaaacttattttaggccttatttggtctctgattgtt
cgatatcaaatcggaagatctaaatttccccccaagaaattgatgctggcttggttaaag
gcaaaatgtaacattcaaaattttacaacggattggaattccggtcaatatttaagtgca
ttattggaatattgcaaacctggattatttccccattggaaaagaatagataaaaccgac
agtgttaacaattgccggcgagcaatggaaattgctagaaaagaatttaacatacctgtt
gtactagaaccagaatatctggcctctccctttttggatgaactatccggaatgacttat
ttatcatacttcatgaaggaatacagtccaggatattacgctactttaaagtgggtccaa
aatcaaatccctgaaaaaaacgttaaaaattttacgacggattggaacgatggtaacgtt
ttatgcagcttagttaaatcattaggaggctctgttcccggttataaatctttgaatttc
gaccctttgttttgggaacaaaatttaatgcagggaattagaggcggagaaaaattagga
gtcgaaccaatattgaaagccaaagacatggctgataaaaatgttgagcatttaggagtt
atggcatatgcagcaaattttcagtggattccaactcgaactgctccaaatcaaaggatt
aaagtttcttctgaaaaacacagttgcagagtcaatgaaaatgtatctttttcaatggaa
tttatggacgaagatgtggatggtagagaaattaaagcgttcgtcattagtccaatcgga
atgactgattgtcgattgaatttgggacagtttggaggaaaagggaattttgtaccttcg
gtggtaggaatgcatcagttgaatgtaagttatgaaggagaaaatgttatcggaagtcct
ctttatgttagagttgctccacctctttcaaacattgaatttcctggtatagaaccttgt
gcgattggaagtattgtcgaagtattggtaaattcatacggcggtagtgcgagtaatgtc
gatgttacagcttggagtcctaccgatcgatctcttccttgtcctgttcaatccaaggat
ggaatctatactgcaaagtttcagcccgatgaagttggtgaatggtcgattgcggttact
cacaagggtgaacacatccaaggaggaccttttccgtgttttgtattcgatccaaatggc
attaaattgcttaacactgacggcgctttacccaacttgccgtttacttttcttttggat
gcttctgaaacgggaggtttaggagatataaagatagatcttgttcacgaaaaaaaatct
gttccacatacatttgaaaaaattgctgaaaatttatataaaattaactttgtaccgaaa
cataatgggaaatacagggtttacgtttatttttgcggtatggatgtacgaggttcgccg
tttgttataagggtgggaacgaaaaaaagaaattcaaccttaccgaaaactactgtaaaa
gacgttctctctaaacccgtaatttcagaatctccaacttttgtaaatcacatgcgaacg
gtcagtcctattttagataattcgagcccactttattctccacaatttgtcaaacaaaca
caatatttaacaaaaaatttgaaaaacaattcaaatataagagataattcggattttgta
tcagtgaataccgttcaagtttctaaagaaccaaatcctccgattaaagttaatttaatt
aatggggaaccatcgagaaagggcattttaaaaactgaaaaatttattaccaatgatgtt
ttatcatctgattcttttaaaaaagaattaatgcaacgtataaaatcgcccaaaagtcca
agttttacaactaatagtactgttttaagttctactcctatcgaaaatcaaacattgaaa
tcttcatcatcttataataaatttgaacgcattcaaagtcccatcgacagatccctaagc
ccgttgaataaagtaacgataacatcaaaagtttacaaatcaaccgaacggagttcaagt
ccaatgataaaaaattccagcccagtaatttttaataatcaaagggattttaatgatatg
gaagaaaacacggataaattttcaaatattaaaagtaagttttttcattattattattta
aggaaaataatcaccagtaaaagtaattcatcctcatattacaacagtttgaatcgcatt
agtaaacaagaaacgtcaaaggattacgtcgatgcttcacatccacgatttttagaaaag
gacaatatttcatttaaaaattcaattaaggtaaattctgttgacaaacctagtccattg
atgtcatcaccatcgccagggttagctcgaggatctgcacaaggcgattctcttaaactt
gtacctataaacgtgcaatccgagatagatttggatttgggtccagatattgtaccctcc
gatgtgaatgttatcattatagcgccttctcgtaaagacgtacctgtcagaataataaaa
tcagtgttcaaaaagaatttatcagctatatttacaacctcggaagtcggagaacattat
gtcgacgtgagagtaaaaaatcaaagaatttctggatcgccatttcgcactcatgcatac
aatgctcgtgctattaaagttggaaatattcctaacggaaaaataggagaatctgtagaa
ttcgagattgatggttctgaagccggatctggaaatcttgagatattggttaatggagga
cacgttacttcctttgtccgaaatcttggtcagcaaaggtttttggcatcatttgttcct
catcaagcattagttcatatgattgaaattaagtttaatggtgaatacgtaccaggtagt
ccttggcgagtgacagtttccagcggcaaagccatggctgttctcggtgaaacagtcaag
ctggtgccagctggttctactgccgaatttttaattagtgctcccggcagttcaaaagga
aattttgatgttcaagtcattagtccatcaaaaaaacaaatcgattcccgcattgtggaa
gaaaaaccttcggaatttagaattgaatttactccaaccgaagtgggaagtcattttgtg
gaagttaaaattaatggagtgaaattagccggtgggccactaattgctaaggtgtataat
agcagcatgataagagttacggatgttgccagtggcgtcgttgggcaaccgtgtcaattt
aaagttgatgctagccaagcaggagaaggacaattggagatttcaataaatgaaggtcaa
gtccccaatcatgtacaggtggtaggtggaggtcgctgtttgatttcttttactcccgaa
caaccgaaaccgcattacataagcatcaagtttaacggcgaaaccatattcggttgtcca
tttgtttgttcggtctccgacaacaacaaagtcacattgtctttgcgtaatttggaactc
attcctgttaaccaagttgctcgttttcatatgaccgtagacgataataacaacgcagaa
cttgctgtgtcagttagaggtcccactggagaattacccgtaaaagtaagcggtaatata
gatagtggctttgttgccgaatttactccaagagaagttggtgcacattctcttaccgtc
gaatataatggacagccagtaggaggaactccttttacttcgaaagcatatgatgctaaa
ggagtttacgttggacctttgcctaaaggtcaagttggaaaaaccttagagtttttagtc
gacgcaagtcaagctggcgaaggaaatttagaaatcacaatatcgtctcggggacataac
atacctactcaagttcttccacaaggcaatgctcggttttccgtttcatttttgcccatt
gaagcatctgaccacgtaatcagtattaatttcaataaagaaagcgtacctggctcacct
tttatagctgaggtacaaggcgattcgccgcataatataacggtttcgggttcgtcatta
agcgcggctccggtcggtaaaaattcttatttcacattgagcaatgtggccggtggtgtt
gaagatatcgaagttaacgttgagggtcccaatggacaaagtgtaccggcacaaatgaaa
gaaaatggaggcggaattcatacagttgaattctctccaaaagttgttggagaacataaa
ataatgataaattatagaggagttgctattgctggaagtccattcaaatgtaaagtttac
gattgcaaagcaattaaagttaaaaatgtggataaaggcgtcgttggaaagcccgtcacg
tttttaggcaatcaagcaggacctggaaatttggaagtgaccgttaatggaggtcgagtt
ccaacatcagctcaagctcagggttcacaaacatatgcaatatcattcacaccccgtgaa
gcgattcctcatactgttgaattaaaatttaattcggagcatttacccggaagccctttt
gtctgccaagctacagatgcggctaaaatagtgatgccttccgagggaatggaaaaagtt
ggcgttggacgtgtggcttcattcgttattgaagctgattctaacatgggcgttttggat
attcaagttttaagtccgactagaaaaaatgttcctgttaatttaaataatttgtcatat
aataaatacgaagcgagtttcactccggaagatgtgggggatcacagtgttgaagtaaaa
atcaatgacaaccacgtcgatggcagcccttttttggtcaaagcttacgatgcgaacaga
gttaaagtggccgacgttaattcaggaatcgtcggaaaacctgttttttttagcattaac
gcttcacaagccggagctggaaatttagaaattatcgtatccgtaaatggtagaaatgtt
ccgaattatgttcagtccgagggtaatgctaaatttcgagtaaattttaaacctcaagaa
gcagctcctcacaatcttagcgtgagatttaacggagagcccgtacctggatctcctttc
gtttgcaaagtattaggaagtaatcaaataattgtttccggccctgcgcttaaaatgaca
ccgatcggtcaagaaacgtgcttatatatcgaccctcaagtaagtaactccggtatcaat
gcgcaatgtcaggtttccatacaatccccaagtgggaaaatgttacccgtcgtattaact
aaattggatggaaaatattcagccagtttcactccggatgaagtcggccgacattccata
gatgctattctcgacaaaaatcttgttaaaggcagtccattcgcatgtaacgtttatgat
gttgctagagttaaaatctctggtttgggacccacaaaagttcaaaaaccggttacattc
agagttgatgcgagtgaagctggtgagggaacgttggaattagttgtttcgacagaacgt
tctacggtgaaagcagaagttgtggcttgtgcaagaggtctctatgacgtcacgtttgtt
ccccacgaagccatagttcattttgtcaatatttcttttaatgaagaagatattccagaa
ggtccgaaggaaaacgtggtcggacagaaaacatttttcgatgttcaagtgtttggagct
aatggtcacatagacatggaaatattagatgaaaaaggttcttgcgtcccttgcaaagtt
caaagaatcacaaacgggaaatacaaagcgattttcactcctaccgttactggagtgcat
cagataacagtttttaacaacgaacaactcatcaataaacaaccttttgttattgaagtt
tttgatcccgcagccgttcacgttttagatttagaacccgttgattctagagaagccggg
cctggaactttaactgttagcgtgagagcagctggaagtcctattaaacattccgtcaaa
gatttgagcgagggtctccacgagataacttttcaccccactatagccattccgcacaaa
atagatattaaatacaacggtctccacattcgtggttgtcctttagagctaccgatcaaa
aatccagccgtcggacaagatgtcatggctactggatcgggattatacgaagcaaaagtt
ggaaaatctagttcttttgtcattgaaacactcggaaatccgagcaaagattttgatata
gttatcacgggtccaaattcttcggcagtacccgttcgatgttaccaacaaaaagatggg
aattttgacccttttgattggtttttaggtttgtacaaaattgaagtgagccacggtacc
cgtccagtcagaggtagtccctacatttgtcacgttcacgattcttcaaaagtaaaaatc
caggatgtaataaaaccggtgtctcttaattctccagcaacacttaaattgatgcgaaaa
ggtgcgggattcgccgaacttgacgtcgcagtgacaagtcctttgggtcaagatttgccc
attcagataaaatctggaccagatagagaatcagatttaatagaatttactcctacgctt
ccaggaaattataaatttaaaataacttacggtggagatgaaattcctggttctcctttg
cttttaacatgcgaggactcggaaccggtaaaagcttacggagatggtattaattacgga
caagtagataatttggttacttttcgggtgaacgcaagtagcaaacccgtaataaaaata
gatggtccagacacgtctccatctccaaaaattgaaatggagagttcgggtgtttatgta
gtatcatatgttccgagagaaatcggagtttttgacattcaagtcatagttggagaccgt
gaaattttgggttctccctttcatccaaagattgtagacgcaagaaaagttagagtcatc
ggtggttgggaaagtatctgtgattcttctggcaaacttgaactacaagttcatcagaca
aaaaaaattagtctcgacgtttcagaagccgggcccggttcattaactgccgaattccga
ggtcccgacggagaaataattccagccgccgttggtcctataacgtctaataaagttaag
gttttactcactcccagggattccggagagcattctttgcatttgtacttcggaggtgtc
ccagttcccggaactcctttaaaagccgatggatcaaccaatggaggacccgtcagagtt
gtgttgacaggaaagggtcttgtttccgccaaatgtcatcaagaagcggaattcacgatt
gacggatcacaagctggtcccggcgtaccggaagcctcgttatccggcagtaaaggagac
gtgcccatcaatttagaaagtatcggagagagcatattcaggggtagttacaccccttca
ctccctggaacttattttcttaacgtcatgtgggccgacagacaagttaaaggttgtccg
ctcaaagtaaatgttacggcttctgcggatgcgtcgcaagttgcttgcagcggcgacggt
ttacgagtgggtaccgtcggcaaagaaatccgatcgttcattgacactcgacgagccggc
cccggggagttgacagctcattgcgtgggacctcacaaggttgcatattgcgagttgtac
gatcacggagatggaacttttacacttaatgttaaaccacaagaatcgggtcgtcacgta
ttgacaataaaatatggcggagatcacgttccgggatctccgtacactctcagagttgcc
ggagcacccgatccatcaaaggtcagagtttacggtccaggtatcgaacacggagtcttg
gcaacttttcaaagcagattcatatgcgatacgaggggtgccggtgccggtcaacttaca
gttagagtgagaggtccaaaaggtgcttttcgtgtcgaaatgcaaagggaaagtcaaaag
gatagaacgattttatgtaaatttcatcctacggaacctggagattatagggtcgaagtt
aaatgggccggagaacttgtacctggttctccatttaatgttatgatttttgatactcag
gaagaactcactcgttttttgcagggtcaacaatccccgggatccgatgtgtacggaagc
gtaagttacggtcacgtacctggatctttgggaagacaatcatggagaggatctcaaccc
actctgtaa

DBGET integrated database retrieval system