KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM086710Help
Entry
Phum_PHUM086710   CDS       T01223                                 

Definition
CREB-binding protein, putative
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:phu04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:phu04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:phu04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:phu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:phu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2172 aa AA seqDB search
MFDLENELPEKLMSTGGSWGAIESSKPSNAGPGPGAGPASSMGPPMQNGALDMPHHLMSQ
GTKGIVNHLQNPVLNTPSSQGLMNSQGMVGTMIMTSSPLNTMGGGHVVTNSLNKQPLPGN
LMPQQGLHPNVSQHQLQNGPILSARAAAMQGHLVRGPGPGQGASGHHIGIGGPRLQGPGP
GPGPGQGMGPMGVTSYTFNSQGVLTPQQRGVPGNVVQIQPQRFSVQGTIGGPSVVNKEGG
AVSAQPPASSPAQPQSGAPTGTQPGPQQATQGGPGLQQQPTQPTSNADPEKRKLIQQQLV
LLLHAHKCQRRESQANGEQWQCILPHCKTMKNVLNHMTTCQAGKSCTVPHCSSSRQIISH
WKHCTRSDCPVCLPLKQADKNRNNANVISNQAVGSQQNPSPSDMRRAYDALGMQCPITGG
QPGPPGGLLTRPATRMVSTEMNQAPMSGSVRLMAPQVVNKSYVVYSLVSPIGPQSASVPG
TGNQVVAPNVSLPLSSDPTTSAMPATTASTVVSATQQAQAIQQTVQNIFTLNDSQGVGCD
NRLSNVPLPGGLTTSQVQATPVQGTKEWHMSVTPDLRNHLVHKLVQAIFPTPDPNAMLDK
RMHNLVAYARKVEGDMYEMANSRSEYYHLLAEKIYKIQKELEEKRQKRKEQQMQAQNPAP
LNVQQNTIRPGLVGPRAQGPIQNTVNQTIRSQSPGMNVQISRVPFQRMVAPGPFSSPSSQ
FNGQPNSQFDMMNTRLQGPATSQSQVNLATNSSFNQQTSQFQSSNINNPARVPPIPSESP
GAVIPGGAASGTSSTVVSSNGSVTIQVPSNLLQHQPNSVPVSTPPSSVPPPATPPGNTTP
SNSNILASLGKGGGQSERDRAARNAVNSMSSQMAAITAALHQDEDSSPSETKDKLDALKE
RELKREQEEQSGGDMSCSRDSSGKCGSVSDIKTEIKSETMDVGREESTTIKEEPMTPSTQ
MGEDTKPSFKIEPIAPSSTDKKPKCPCPCLFKPDELRQALMPTLEKLYRQDPESVPFRTK
VLCCYGKQLCTIPKDAKYFSFQNRYTFCQKCFNDIPGDTVTLGDDPSQSQSVIKKDQFKE
LKNDHLELEPFVACSDCGRKLHQICVLYMEAIWPNGFTCDNCLKKKGAKRKENKFNAKRL
PVTKLGTYIETRVNNYLKKKEAGAGEVAIRVVSSSDKIVEVKPGMRNRFVDNGDLPEQFP
YRAKALFAFEDVDGADVCFFGMHVQEYGSDCPTPNTRRVYIAYLDSVHFFRPRQFRTAVY
HEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPAEQKIPKPKRLQEWYKKMLDKG
IIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAA
EAAANDAGEGGSDGKKKGQKKAKKSNKSKANQRKNSKKSNTPQTGNDLSAKIFATMEKHK
EVFFVIRLHSAQSAASLAPIQDPDPFINCDLMDGRDAFLTMAREKHYEFSSLRRAKYSSM
AMLYELHNQGQDKFVYTCNNCKSHVETRYHCTQCEDFDLCVQCYDKEGHPHKMEKLGFDL
DDGSPVEGQKANPQEARKLSIQRCIHSLVHACQCRDANCRLPSCQKMKRVTQHTKVCKRK
TNGGCPICKQLIALCCYHAKHCPEQKCPVPFCLNIKHKLKQQQLQHRLQQAQLLRRRMAV
MNTRAKPTSTPSSQAVSFLTLPFLNKTRNRNLISGQNVMLPMQSPHQGIGLKPGAQTPPP
NVLQVVKQVQAEAARQQAPHGNFGKVNPPQAVMPPPIQQRISNIGQHLLPMDQWTPRYPN
NTQQQQPQNNIGPGIRQPGQQVMPQQPVVPQQQVPQQAQAQQQQPPPPPQQQQMMVGLRP
GGGAGLPPGSQVQVAGGGTMPKQALQQLLQTLKSPNTPDQQQQILQILKSNPQLMAAFIK
QRQTYQHQMQQGQNPPGPMTNAQGPSCSNQGSPAMNNPQLQHMLSQQQQHQNRLQMQMQI
PGQQMAQQNPQQQQQQQQGQQQAHWYKQQLLAMTQRQQQQQQQQQFQQPPGYPQRLPGMR
PQMNYGGPGYKPTPPPVPSPQGVMGPPGSNLVQQQLMSVRSPPPIRSPQPNPSPRPVPSP
RNQPVPSPHHGPMSSPHHELGGEMLGLTQLAGGQPSHHNSAGGPPSNPPSQENADVTPMT
PQDQLSKFVEQL
NT seq 6519 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttggaaaatgaacttcctgaaaaacttatgtctacaggaggttcatggggt
gcaattgaaagcagcaagccttctaatgctggtccaggaccaggtgcgggtcctgcatca
agcatgggtcctccaatgcaaaatggagcattagatatgcctcatcacctaatgtcacaa
ggaacaaaaggaattgtaaatcatttacaaaatcctgttttaaacactccaagcagtcag
ggattgatgaatagtcaaggaatggtgggcacaatgattatgaccagtagccctcttaac
accatgggcggtggacatgttgtaacaaactcattaaataaacagccactgcctggtaac
ttaatgcctcagcagggtcttcatcccaatgtaagtcaacatcagcttcagaatggtcct
attctttcagcaagggcagcagcaatgcaggggcatttagttagaggacctggacctggt
caaggtgcatcaggtcatcatataggcataggggggccacggctgcaggggcctgggccg
ggaccaggtccggggcaaggaatggggccaatgggggttacttcttacacattcaattct
caaggagttttgactcctcaacaaagaggagttcctggtaacgttgttcaaatacagcct
cagaggtttagtgttcagggtacaattggtggcccttcagttgtaaacaaggaaggtgga
gctgtttctgctcaacctccagcttcaagtccggctcagcctcaatctggagctcctacc
ggaacacaacctggtcctcagcaagccactcaaggcggcccaggtttgcagcaacaacca
acgcaaccaacatctaatgctgacccagaaaaacgaaaattaattcaacagcaactggta
ttgcttttgcatgctcataaatgtcaaagaagggaaagccaagcaaatggagagcagtgg
cagtgcatattgcctcattgcaagaccatgaaaaacgttctaaaccacatgacaacatgt
caggcaggaaaatcctgtaccgtccctcattgttcttcttctaggcaaataatttcacac
tggaagcattgcactcgttctgactgtcccgtttgtttgcctctaaagcaagccgataag
aatagaaataatgcaaatgtgatctcaaatcaagctgttggaagtcaacaaaatccatca
ccatcggatatgagaagagcttatgacgccttaggtatgcaatgtcctattactggtgga
cagccaggaccccctggtggcttacttactcgccctgctacgcgaatggtttctaccgaa
atgaatcaagctccaatgtcaggcagcgtgcgacttatggcaccacaagtcgtaaataag
tcttacgtggtttattcgcttgtatctccaataggtccccaaagtgcatctgttcctgga
actgggaatcaagtggttgctcctaatgtcagccttccgcttagtagtgatccaacgact
agtgcaatgccagccacaactgctagcactgtagttagtgctacgcagcaggcacaagcc
atacaacagactgttcaaaacattttcacactcaacgattctcaaggggttggatgtgat
aataggctaagtaatgttccgcttcctggggggttaactactagccaggttcaagcaact
cctgttcagggaaccaaggaatggcacatgtcggtcactccagatcttcgtaatcattta
gttcataaattagtgcaagcaattttccccacccctgatcctaatgcaatgctcgataaa
agaatgcataatcttgtagcttacgctaggaaagttgaaggtgatatgtacgaaatggct
aattcacggtctgaatactaccatttactagccgaaaaaatttataaaattcaaaaagaa
ctagaagaaaaaagacagaaaagaaaagagcagcaaatgcaggcgcaaaatcctgctccc
ttaaacgttcagcaaaataccattaggccaggtttagtaggaccaagggctcagggccct
attcaaaataccgttaatcaaacaattcgatctcaaagtcccggaatgaatgttcaaata
agtcgagtaccatttcaacgtatggtcgcaccaggaccatttagttctccttctagtcag
ttcaatggacagcctaatagccaatttgatatgatgaatacaaggctgcaaggaccagca
acatctcagtcccaagttaatctcgctaccaattcttctttcaatcaacaaacatctcag
tttcaatcttcaaatattaacaatcctgctagagttccgccaatacccagtgaaagtcct
ggtgctgtcattcctggaggtgctgctagtggaacttcttcgacggttgtatctagtaac
ggctctgtcactattcaagttccttctaatttactgcaacaccaacctaatagtgttcca
gtttctacacctccatccagcgttccacctccagccactcctcctgggaatactacgcct
tccaatagtaatattttagcaagtttaggtaaaggtggaggccaaagtgaacgtgataga
gcagctagaaatgcagtaaactcaatgtcttctcagatggccgccataactgcagctctt
catcaggatgaagattcttcgccaagtgaaaccaaagacaaacttgatgctcttaaagag
cgtgaacttaaaagagaacaggaagaacaatcgggaggtgatatgagttgcagccgggat
agttctggtaaatgcggaagcgtatcggatataaaaactgaaattaaatcggaaacgatg
gatgttggaagagaagagtcgactaccattaaagaagaaccaatgactccttctactcaa
atgggagaagatactaagccgagttttaaaatcgaacccatagcacctagtagtacggat
aaaaaacccaaatgtccgtgtccttgtctttttaaacctgatgaacttagacaagcttta
atgcccacgttagaaaaattgtaccgacaagatccagagtctgtaccattccggactaaa
gtactttgttgctacggaaaacaactttgtaccattcctaaggatgcaaagtattttagt
tttcaaaacaggtacacattttgccaaaagtgttttaatgacattccgggggacaccgtg
acactaggagacgatccaagtcaatctcaatcggtaattaaaaaggaccaattcaaggaa
ttaaaaaacgatcatttagagttggagccttttgtagcctgcagtgattgcgggagaaaa
ttacatcagatttgcgtgctttacatggaagccatatggccaaatggatttacttgtgat
aattgcctgaaaaagaagggtgcgaaacgtaaggaaaataaattcaatgccaaaaggctt
cccgtgacaaaattaggaacctacatcgaaacaagagtgaataattacttgaagaaaaaa
gaagcgggagcaggcgaagtcgcgatccgagtggtttcgagttcggataaaatagtggaa
gtcaaaccgggaatgagaaatagatttgttgacaatggcgatcttccagaacaatttcca
tatagagcgaaagctttatttgcatttgaggacgtggatggagccgacgtttgttttttc
ggaatgcacgttcaagaatacggttctgattgtccgacaccgaacactaggcgcgtttac
atcgcgtatttagactctgtacatttctttaggcctaggcagttccgtacggcggtatat
catgaaattttactaggatatctggattatgtaaagcaattaggttacacaatggcgcat
atttgggcatgtccaccgtctgaaggtgacgattatatttttcattgtcatcctgctgaa
cagaaaataccaaagcctaaaagacttcaagaatggtataaaaaaatgttagacaaaggc
attatagaaaggatagttttagattataaagatatactaaaacaagcaatggaagataaa
ttaagttcagctgcggaattaccttatttcgagggagacttttggcctaacgttttagaa
gaaagtattaaagagttggatcaagaagaagaggagaaaagaaaacaagcggaggctgca
gaagctgctgcaaatgatgctggcgaaggtggatcagatggtaagaaaaagggacagaaa
aaagctaaaaagtcaaacaagtcgaaagctaatcaaaggaaaaatagtaaaaaatcgaat
actcctcaaactggaaatgatttgtcggctaaaatatttgccacaatggaaaagcacaaa
gaagtattttttgtcattagacttcactctgctcaaagtgctgcaagtttagctcccatt
caagatcccgatcctttcattaactgtgatttaatggacggcagagatgcctttttaaca
atggccagagaaaaacattatgaattttcatcgttgagaagagcaaaatattcgagcatg
gccatgctgtacgagttacacaatcaaggtcaagacaaatttgtatacacgtgtaataac
tgcaaaagccacgtggaaacaaggtatcactgcacgcaatgcgaagatttcgatttgtgc
gttcaatgctacgacaaagagggacatccgcataaaatggaaaaattgggtttcgatctc
gatgacggttcgcccgtcgagggtcaaaaggccaatccgcaagaagctagaaaattgtcc
attcagaggtgtattcactcattggttcacgcttgtcaatgtcgcgatgctaattgtagg
ttgccaagttgtcagaaaatgaagagggtgacgcagcacacaaaagtttgtaagagaaaa
acaaacggtggttgtcccatttgtaagcagcttattgctctatgttgctaccatgcgaaa
cattgccctgaacaaaaatgtccggtacctttctgtctaaatattaaacacaaattaaaa
caacaacaacttcaacataggttacaacaggctcaattattaagaagaagaatggctgtt
atgaatacaagagcgaaaccgacttcaactccatcctctcaggctgtaagttttctcaca
ttgcctttcttaaataaaacccggaatagaaatttaattagtgggcaaaacgtaatgcta
cccatgcaatcacctcatcaaggaatcggcttaaagcccggggcacaaactcctccgcca
aatgtacttcaagtcgtcaaacaggttcaggccgaagcggcgagacagcaagcgccgcat
gggaatttcggaaaagttaatccgcctcaggctgtcatgccgcctccaattcaacaacgt
ataagcaatataggtcaacatttattaccaatggatcaatggacgccgaggtatcccaac
aatactcagcaacagcagccgcagaataatatcggtcccggaattaggcaacccggacaa
caagtaatgcctcaacaaccagtagtaccgcaacaacaagtacctcagcaagctcaagcg
cagcaacaacagcctcctcctccgcctcaacaacagcaaatgatggtcggccttcgtccg
ggaggaggggctggattaccacccggttctcaggttcaagtcgccggaggtggaacaatg
ccaaaacaagctcttcaacaattgttgcaaacgttaaaatcgccaaacacgcctgaccaa
caacagcaaattttacagatacttaagagcaatccgcaattaatggcagcttttattaaa
caaaggcaaacgtatcaacaccaaatgcagcagggtcaaaaccctcctggaccaatgacg
aatgctcagggtccatcatgctcaaatcaaggtagccctgccatgaataatcctcaatta
cagcacatgttaagtcagcaacagcagcatcagaataggttacaaatgcaaatgcaaata
ccgggccagcaaatggcgcaacaaaatcctcaacaacaacaacaacaacaacaaggacag
caacaagctcactggtacaaacaacaattattagcaatgactcagcgtcaacagcagcag
cagcagcaacaacaattccagcaaccgcccggatacccacaaaggttgcctgggatgagg
cctcaaatgaattacggtggtcccgggtacaagccgactccacctcccgttccgtccccg
caaggagtcatgggccctcccggctcgaatcttgttcagcaacaactcatgtccgtcagg
tctcctcctccgatacgttcgcctcaaccgaacccgagtccgcgacccgtgccgtctccg
cgtaatcaacccgtgccgtcgccccaccacggccccatgtcttcgcctcatcacgagttg
ggcggcgaaatgctcggactcacacaactcgcggggggtcaaccgtcgcatcataattcc
gccggcggacccccgtcgaatcctccgtcgcaggaaaacgcggatgtgactccgatgact
cctcaggaccaactgtcaaaatttgttgaacagttatag

DBGET integrated database retrieval system