KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM087110Help
Entry
Phum_PHUM087110   CDS       T01223                                 

Definition
dfg10 protein, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Phum_PHUM087110
    1.3.1.94  polyprenol reductase
     Phum_PHUM087110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 303 aa AA seqDB search
MELPDVNYLQLIMLFMTFTILILGSMINYFENYIPVFVSQTFRYGKFAYRGKPSKLKVIE
VPKSWFKHFYVFASVYCVCALYFAIDVYLYDATPPKWLLSYLDFLCGSTRSTDCDMNAII
IALTLLTLQSFRRFYETWFLSVFSKGNINLSQYLIGYIHYWATVTIILGEASGFKEGSLI
TQTSLNPIQGFGIVLFCFGWINQYKSARILSYLRRNFTGNVVTTEHKIPRGGLFEYISSP
HLTCEVLMYLSIYLILYKNQTFKYVFFWVLSNQVETSLLNHWWYQKTFKNYPKTRKAFLP
FVL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaactacctgacgtgaattatctccaacttataatgttatttatgacttttactatt
ctcatattgggtagtatgattaactattttgaaaattatataccagtttttgtttcgcaa
acgtttcgttacgggaaattcgcatacagaggaaaaccgtcaaaattaaaagtaattgaa
gtacccaaaagctggtttaaacatttctacgtttttgctagcgtatactgcgtatgtgca
ttatattttgcaattgacgtttatctatatgacgctacaccgccaaaatggttactttct
tatttagattttttgtgtggatctacacgcagcacagattgtgacatgaatgcaatcata
attgcactcacacttttgacactacagtcatttcgtagattttatgaaacatggttttta
agtgttttttccaagggtaatattaatctttcacaatatttgattggttatattcattat
tgggccacagttacaattattttaggagaagcatctggatttaaagaaggtagcttaatt
acacaaacatctttgaacccaatacaaggatttggaattgtattgttttgctttggttgg
atcaatcagtataaatcggctaggatattatcttatctcagaagaaattttactgggaat
gttgttacaacagaacacaaaattccaagaggtggattattcgaatatatttcatctccg
catttaacatgtgaagttttaatgtatttatccatatatctcatcttatataaaaatcaa
acatttaaatatgttttcttttgggttttgagtaatcaagttgaaacatcattgttaaat
cattggtggtatcaaaaaacatttaaaaattatccgaaaaccagaaaagcatttctacca
tttgtactttaa

DBGET integrated database retrieval system