KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM090820Help
Entry
Phum_PHUM090820   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM090820
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  PKA family
   Phum_PHUM090820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 8238002
NCBI-ProteinID: XP_002423871
VectorBase: PHUM090820
UniProt: E0VCM7
AA seq 287 aa AA seqDB search
MKYLAMKILLISDVIRLKQVEHVKNEKRILEEIQHPFIVNLWCSWKDNSRLYMLFDYVCG
GELFSYLRNYGRFNTTTANFYSCEVILALEYLHSQSVVYRDLKPENLLLDQDGHLKIIDF
GFAKKLTDRTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGVLIYEMLAGHPPFFDSYPFG
IYEKILAGKIEWFRQIDPVAKDLIKKLLVHDRTKRLGNMKNGAEDVKRHRWFKEIDWTEV
YYKQLKPPILPHVKYDGDTRNFEDYPESDWKSKPSVGESELKLFEDF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctggcaatgaaaatcctattgataagcgacgtaatacgattgaaacaagtc
gaacacgttaaaaacgagaaaaggattctggaagaaatccagcatccgttcatcgttaac
ctttggtgcagttggaaagataattctcgtttgtacatgttgttcgattacgtttgcggc
ggcgaattattttcctatttgagaaattacgggagattcaacacgacgacggcaaatttt
tactcgtgtgaagtgatattagctttagaatatttacacagtcaatccgtcgtttataga
gacttgaaacctgaaaatttacttttggatcaagatggacacttgaaaataatcgatttc
ggttttgccaaaaagctaacggatcgaacgtggacgctgtgcggtactccggaatattta
gcacccgaaataatacaatcgaaaggtcacaacaaggccgtcgattggtgggcattgggt
gttttgatttacgaaatgttagccggtcatcctccctttttcgacagttatccatttgga
atatacgaaaaaatattagctggaaaaatcgaatggttcagacaaatcgatcccgtcgcg
aaggatctcattaaaaaattactcgtacacgacagaacgaaaagattaggaaacatgaag
aatggagccgaagatgtaaaaaggcatagatggtttaaagaaatcgattggacggaagtt
tactacaaacagttgaagccccccatattgccgcacgtcaaatacgacggagacacgaga
aattttgaagattatccagaaagcgactggaaatcgaaaccatccgttggagaatccgaa
cttaaactctttgaagatttttaa

DBGET integrated database retrieval system