KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM090820Help
Entry
Phum_PHUM090820   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM090820
   04340 Hedgehog signaling pathway
    Phum_PHUM090820
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM090820
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Phum_PHUM090820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 287 aa AA seqDB search
MKYLAMKILLISDVIRLKQVEHVKNEKRILEEIQHPFIVNLWCSWKDNSRLYMLFDYVCG
GELFSYLRNYGRFNTTTANFYSCEVILALEYLHSQSVVYRDLKPENLLLDQDGHLKIIDF
GFAKKLTDRTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGVLIYEMLAGHPPFFDSYPFG
IYEKILAGKIEWFRQIDPVAKDLIKKLLVHDRTKRLGNMKNGAEDVKRHRWFKEIDWTEV
YYKQLKPPILPHVKYDGDTRNFEDYPESDWKSKPSVGESELKLFEDF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctggcaatgaaaatcctattgataagcgacgtaatacgattgaaacaagtc
gaacacgttaaaaacgagaaaaggattctggaagaaatccagcatccgttcatcgttaac
ctttggtgcagttggaaagataattctcgtttgtacatgttgttcgattacgtttgcggc
ggcgaattattttcctatttgagaaattacgggagattcaacacgacgacggcaaatttt
tactcgtgtgaagtgatattagctttagaatatttacacagtcaatccgtcgtttataga
gacttgaaacctgaaaatttacttttggatcaagatggacacttgaaaataatcgatttc
ggttttgccaaaaagctaacggatcgaacgtggacgctgtgcggtactccggaatattta
gcacccgaaataatacaatcgaaaggtcacaacaaggccgtcgattggtgggcattgggt
gttttgatttacgaaatgttagccggtcatcctccctttttcgacagttatccatttgga
atatacgaaaaaatattagctggaaaaatcgaatggttcagacaaatcgatcccgtcgcg
aaggatctcattaaaaaattactcgtacacgacagaacgaaaagattaggaaacatgaag
aatggagccgaagatgtaaaaaggcatagatggtttaaagaaatcgattggacggaagtt
tactacaaacagttgaagccccccatattgccgcacgtcaaatacgacggagacacgaga
aattttgaagattatccagaaagcgactggaaatcgaaaccatccgttggagaatccgaa
cttaaactctttgaagatttttaa

DBGET integrated database retrieval system