KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM101680Help
Entry
Phum_PHUM101680   CDS       T01223                                 

Definition
NADPH--cytochrome P450, putative (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Phum_PHUM101680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 678 aa AA seqDB search
MQVEAETGAEVLKEEPIFGVLDIILFLALIGVGAWWLLKDWKKPELTQTKSYTIQPSSLG
TQSSDNSFIQKLKSSGRSLVAFYGSQTGTGEEFAGRLAKEGIRYRMKGMVADPEEYDMEE
LVNLRDIPNSLAVFCLATYGEGDPTDNAMEFYEWLHSDIDLTGLNYAVFGLGNKTYEHYN
EVAIYVDKRLEELGATRVFELGLGDDDANIEDDFITWKDKFWPAVCEYFGLEGAGEDVSV
RQYRLTEHEEYNPERVFTGEVARLQSLKNQRPPYDAKNPFLSQIKVNRELHTGGDRSCMH
IEFDIEGSKMRYDSGDHLAVYPVNSSELIEKLGSLLNFDLDRVFTLTNTDEESSKKHPFP
CPCSYRTAFRHYLDITSNPRTHILKELSEYATDPKEKEMLKLMSSTSPEGKALYQKWIIE
DNRNIIHILEDLPSCTPAIDHLCELLPRLQCRYYSISSSAKLYPTSVHVTAVLVQYETPT
NRVNKGVATSWLKTLVPAGGEGEEKEFPSAPIFIRKSQFRLPTRMQTPIIMIGPGTGLAP
FRGFIQERHLAKEEGKPIGDTILYFGCRKKSEDFLYKEELEKYVESGTLKMHVAFSRDQP
EKIYVTHLLSQNADELWEVIGENNGHLYICGDARTMARDVNDIVRKVLIDKGNMTEQQAQ
AYLKKMEAQKRFSSDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcgaagcggaaacaggagcggaagtactcaaagaagaacccatatttggagtt
cttgacataattcttttcttagctttaatcggagttggagcttggtggttgctcaaagac
tggaagaagccggaattaacacaaacgaaatcatatacgatacaaccctcgtctttgggc
actcaatcctcagacaattcgtttatacaaaaactcaaatcatccggaagaagtcttgtc
gctttctatgggagtcaaacgggaacgggtgaagaatttgccggacgattggcaaaagag
ggaataagatataggatgaaaggaatggttgcagatcccgaagaatacgatatggaagaa
ttggtcaatttaagagatatcccgaattctttggcagttttttgcctcgcaacatacggc
gagggggatccaacggataatgctatggaattttacgaatggctacattcggatatcgat
ttgacgggattaaattatgccgtgttcggtttaggtaataaaacatacgaacattataac
gaagtcgccatttatgtggataaaagattagaagaattgggagcaacgagagttttcgaa
ctcggattgggagatgacgatgcaaacatcgaagatgattttattacttggaaagataag
ttttggccggccgtttgcgaatattttggactcgaaggtgcgggtgaggatgtgagcgta
cgtcaatatcgtcttacggaacacgaggaatacaatccggaaagagttttcaccggagaa
gttgccagacttcaatctttgaaaaaccaaagaccgccgtacgatgcaaaaaatccattc
ctttctcaaataaaagttaacagagaattgcacacgggtggagatagatcttgcatgcac
atagaattcgatatcgagggatccaaaatgagatacgacagcggtgaccatttagccgtt
tatcctgtcaacagtagcgaattaatagaaaaacttggatccctgttgaatttcgattta
gaccgagtttttacattaaccaatacggatgaggaatcgagcaaaaaacatccatttcca
tgtccttgttcgtacaggacggcttttagacattatttggacatcacaagcaatccgaga
acacacattttaaaagaactttcggaatatgcaacggatccaaaggaaaaagaaatgctc
aaattaatgtcaagcacttctcccgaaggtaaagcactctatcaaaaatggatcatcgaa
gataatcgtaacataatacacattttggaagatttacccagttgcacgccggccattgat
cacttatgcgaattgctaccacgtttacaatgtcgatattattccatttcatcttctgct
aagttgtatccaacgtccgttcacgtcacggccgtactcgtacaatacgaaacgccaacg
aatagagtcaataagggagtcgcgacgtcctggttaaaaactttagtaccggctggagga
gaaggagaagaaaaagaatttccatcggctcctattttcatcaggaaatcccaattcagg
ttgccaacgcgaatgcaaactccgattataatgataggtccgggtacaggtttagctcca
tttagaggatttattcaagagagacatttagctaaagaagaaggtaaacccatcggtgat
accattttgtatttcgggtgtaggaaaaaatccgaagattttctttataaagaagaatta
gaaaaatacgtcgagtcaggaacgcttaaaatgcacgtggcattttcaagggatcaacct
gaaaaaatatacgtcacgcatttattgtcacaaaacgcggatgaattgtgggaggtcata
ggagaaaataatggtcacctttacatatgcggggatgcgagaacgatggctagagacgta
aacgatatagtacgaaaggttctcattgataagggtaacatgacggaacaacaggctcag
gcatatttgaaaaaaatggaagcacaaaaaagattttcatcggatgtgtggagttga

DBGET integrated database retrieval system