KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM105560Help
Entry
Phum_PHUM105560   CDS       T01223                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:phu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Phum_PHUM105560
   04142 Lysosome
    Phum_PHUM105560
Exosome [BR:phu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Phum_PHUM105560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1680 aa AA seqDB search
MTQGLPIRFQEHLQLTKVGINQNSVSFGTLTMESDKFICVRETIGETSQVVIIDMNDVSN
PIRRPISADSAIMNPASKVIALKGKAGAEAQKTLQIFNIEMKSKMKAHAMTDDVIFWKWI
SLNTLALVTESSVYHWSMEGDSTPQKMFDRHSSLNACQIINYRTDPNQAWLLLIGITVQG
NRVAGAMQLYSVERKCSQPIEGHAAAFAQFKMEGNAEMSTLFCFAVRSVQGGKLHIIEVG
QPPAGNQPFTKKAVDVFFPAEAVNDFPVAMQASPKYDVIYLITKYGYIHLYDIETATCIY
MNRISSDTIFVTAPLEATGGIIGVNRKGQVLSVTVDEDNIIPYINTVLQNPDLALRIAVR
NNLAGAEDLFVRKFNQLFQNGQYVEAAKVAANAPKGILRTPQTIQRFQQVPTPSGQTSPL
LQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKQADPTL
ALSVYLRANVPNKVIQCFAETGQFQKIVLYAQKVGYTPDYIFLLRNVMRVNPEQGVAFAQ
MLVQDDEPLADTNQIVDIFMEQNMVQQCTAFLLDALKNNRPSEGPLQTRLLEMNLISAPQ
VADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNSEWLVGY
FGTLSVEDSLECLKAMLTNNIRQNLQTCVQVATKYHEQLTTKALIDLFESFKSYEGLFYF
LGSIVNFSQDQEVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPL
IIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDIIKNLIL
VVRGQFSTDELVEEVEKRNRLKLLLPWLESRVHEGCVESATHNALAKIYIDSNNNPERFL
KENQFYDSRVVGKYCEKRDPHLACIAYERGQCDRELINVCNENSLFKSEARYLVRRCDPE
LWAEVLSENNPYKRQLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVLD
NSVFSDHRNLQNLLILTAVKADRTRVMEYINRLDNYDAPDIANIAISNQLYEEAFAIFKK
FDVNTSAIQVLIDHIQNLDRAYEFAERCNEPAVWSQLAKAQLQQGMVKEAIDSFIKADDP
SAYMDVVQTASKTNSWEDLVRYLQMARKKARESYIESELIYAYARTNRSSDLEEFISGPN
HADIQKIGDRCFEDKMYEAAKLLYNNVSNFARLAITLVHLREFQGAVDSAKKANSTRTWK
EVCFACVDSEEFRLAQMCGLHIVVHADELEDLINYYQDRGYFEELINLLEAALGLERAHM
GMFSELAILYSKYKPSKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNA
VIAMMAHPTEAWREGHFKDIITKVANIELYYKAIQFYLDYKPLLLNDMLLVLAPRMDHTR
AVSFFTKVNHLQLVKPYLRSVQSLNNKAINEALNQLLIDEEDYLGLRTSIDAFDNFDNIA
LAQKLEKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLFKDAMEYAAESKNPEVAEELL
AWFLEKECYDCFAACLFQCYDLLHPDVILELAWRHNIMDFAMPYLIQVLREYTSKVDKLE
EAESQRVEETAHQENKPMMIPEPQLMLTAGPGMMGTGYAPAYPQTAYSPNPGMPYQGYGM
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggattaccgatacgttttcaggaacatctgcagctcactaaagtgggtatc
aatcagaatagtgtctcatttgggacactcacaatggagtcagataaatttatatgcgtc
agagaaacaattggtgaaacttcacaagttgtaatcattgatatgaacgatgtatcaaat
ccaataagacgtccaatatcggcagattcagcaattatgaatccagcttctaaagtgata
gctctaaaaggaaaagctggtgctgaagctcaaaaaacacttcaaatattcaatatagaa
atgaaaagcaaaatgaaagctcatgcgatgaccgatgatgtcatcttttggaagtggatt
tcattgaacactttagcactcgtaacggaatcatcagtctatcactggagcatggaaggt
gattcaacgcctcaaaaaatgtttgatcgccattcttctttaaatgcatgccaaataata
aattacagaactgatccgaatcaagcatggcttttacttattggtattaccgttcagggt
aatcgtgtagcaggagccatgcaattgtactcggttgagagaaaatgttcacaacctatt
gagggtcatgctgctgctttcgctcagtttaaaatggaaggaaatgcggaaatgtcaacg
ttgttttgctttgccgtgcgatccgttcaaggaggtaaacttcacataattgaagtaggt
cagcctccggctggcaatcaacctttcacaaaaaaagcagttgatgtttttttccctgcc
gaagctgttaatgattttcctgttgcaatgcaggcaagtccaaaatacgacgttatttat
ttaatcaccaagtatggatatattcacttgtacgacattgagactgcaacttgcatttat
atgaatcgaataagttccgatactatattcgtgactgctcctcttgaggctaccggaggc
atcatcggagttaacagaaaaggacaggttttatctgttaccgtggatgaggacaatatt
attccatacatcaatacggttcttcagaaccctgatcttgctttgagaatagccgtcaga
aataatctcgcgggtgctgaagatttgtttgttcgcaagttcaatcaactgtttcaaaat
ggacaatatgtggaagccgccaaggttgcagcaaacgcgccaaaaggtattttaagaact
cctcaaacaatacagagatttcaacaagttcctactccttcaggacaaacctcgcctcta
ttgcagtattttggaattttactagatcagggtcagttgaataaatatgaatcgttggaa
ttatgtcgacctgttttgcaacaagggcgtaaacaattgcttgaaaaatggttgaaagaa
gataaacttgagtgttctgaagaattgggagatttggtaaaacaagcagatccgacattg
gcactttccgtttatttaagagcaaacgttcccaacaaagtcattcagtgtttcgcagaa
actggacaatttcaaaaaattgttctttacgcccaaaaggttgggtacactcccgactac
atatttcttttgcgcaatgtgatgcgagttaatccggagcaaggagtagcttttgctcag
atgctagtacaggatgatgaaccattagcagatacaaatcagattgtggatattttcatg
gagcagaatatggttcaacaatgtacagcatttttactggatgctttaaaaaataatcga
ccgtccgaagggcctttacaaactcgattactcgaaatgaatttgatatcggctcctcag
gtcgcggatgcaattttaggaaatcaaatgtttacccattatgatagagctcacatcgct
caattgtgtgaaaaagcaggcttacttcagagagctctggaacattacactgatctttac
gacattaaaagagcggtcgttcacacccacttgctaaattccgaatggctcgttggatac
tttggaactttgagcgtggaagattctttggaatgtttgaaagcaatgttaacgaataac
attcgtcaaaacttacaaacttgcgttcaagttgctacgaaatatcacgaacaacttacg
acaaaagctctcatcgatttatttgaaagtttcaaaagctacgagggtttattttatttc
ctaggatcgatcgttaatttttcgcaagaccaagaagttcatttcaagtacattcaagca
gcttgcaaaactggacaaatcaaagaagtggaaaggatttgcagggaatcaaattgttac
aatccggaacgtgtgaaaaactttttgaaagaagcaaaattaaccgatcaattgcccttg
attattgtgtgcgatcgtttcgattttgtgcacgatttggttttgtatttgtatcggaat
aatctacaaaaatacattgagatttacgtgcaaaaggtgaatccgtctcgccttcccgtt
gttatcggaggcctgttagacgtcgattgttctgaagacataattaaaaacctaatatta
gtcgtaagaggtcaattttcaactgacgagctagtcgaggaagtggaaaaaagaaaccgt
ttgaaacttttattgccttggctcgaatcgagagttcacgagggttgcgtcgaatcggcg
actcataatgctctcgcaaaaatttatatcgatagcaataataatccggaaagattttta
aaggaaaatcaattttacgacagcagagtcgtcggaaagtattgtgaaaaaagagatcca
cacctggcatgtatcgcctacgaaaggggtcaatgcgacagggaattgattaacgtttgc
aatgaaaattcactctttaaatccgaagctcggtatttggtgagaagatgtgatccggaa
ttgtgggctgaagtattaagtgagaataatccgtacaaacgtcaactgatcgatcaagtc
gttcaaacggctttaagtgaaactcaagatcccgaagatatttcggtcacggttaaagca
tttatgaccgcggatttaccgaacgaattaattgaacttttggaaaaaattgttttggac
aattccgtttttagtgatcacaggaatttgcaaaacttgttgattttaacggccgtcaaa
gccgatagaactcgagttatggaatacataaatcgattggataattacgatgctccggat
atcgctaatattgctatcagtaatcaattatacgaagaagcttttgctattttcaaaaag
tttgacgttaacacttctgctatacaagttttaatagatcacattcaaaatttggatcgc
gcctacgaatttgccgaaaggtgcaacgaacctgccgtgtggagtcaacttgctaaagct
cagttgcaacaaggaatggtcaaagaggccatcgattcatttatcaaagcagacgatccc
tcggcttacatggacgtcgttcaaacggctagcaaaacaaacagttgggaagatttggtt
cgttatttacaaatggcgagaaagaaagctcgagagtcttacatagaaagtgaacttatt
tatgcttatgcaagaacaaatcgatcgtccgatttggaagaatttatatcgggacctaat
catgcggatattcaaaagatcggtgacagatgtttcgaagacaaaatgtacgaagctgct
aaattgctttacaataacgtgagtaattttgctcgtcttgcgattactctcgttcatttg
cgggaatttcaaggtgccgtagactcggcgaaaaaagccaacagcaccaggacgtggaaa
gaagtttgttttgcatgcgtcgattcggaagaatttcggcttgcgcaaatgtgcgggctc
cacatagtggtgcacgccgacgaattagaagatttgataaattattatcaggatagagga
tatttcgaagaattgatcaaccttttagaagccgctttaggattggaaagagctcacatg
ggaatgttcagtgagctggctattttgtattccaagtataagccgagcaaaatgcgtgag
catttggaacttttctggtcgcgagtcaacattccaaaagttttaagagctgccgaacaa
gctcatttgtggtccgagttggttttcctgtacgacaaatacgaagaatacgataacgcc
gtcattgcgatgatggcacatcccacggaagcatggagagagggtcattttaaagatata
ataaccaaggttgccaacatagaattgtactataaggctatacagttttatttagattat
aaaccgttgttactcaacgatatgttgttggttctcgctcccagaatggatcacactcgc
gcagtcagtttctttaccaaagttaatcatctgcaactcgtaaaaccttatttacgctca
gtccaaagcctcaataacaaagctataaacgaagcacttaatcaattgctaatcgatgaa
gaagattacctgggtcttcgaacgtcgattgacgcctttgacaatttcgataacattgct
ttggcacagaaattagaaaaacacgaattaacggaattccgtagaatcgctgcgtatttg
tataagggaaacaaccgttggaaacaatccgtcgagctgtgtaaaaaagacaggcttttt
aaggacgccatggaatatgcggcagaatcaaaaaatccggaagttgctgaagaattgttg
gcttggtttttggaaaaagagtgttacgattgctttgctgcttgtttattccaatgttac
gatcttctacatcccgatgttattttggaactcgcttggcgtcataacattatggatttt
gccatgccctatttaattcaagttctcagagaatatacgagtaaggtagacaaattagaa
gaagctgaaagtcaaagagtcgaagaaacagcacatcaggaaaataaaccgatgatgatt
cctgaaccacagttgatgttaactgctggacccggaatgatgggaaccggttatgcgcct
gcatacccgcaaacggcttattctccgaatccaggaatgccttatcaaggctacggcatg
taa

DBGET integrated database retrieval system