KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128040Help
Entry
Phum_PHUM128040   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:phu04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:phu04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:phu04391]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:phu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MVTWGDREGIFKIKLNDAARCPVGLRLKIIFSIQTVRECTMTSRGTSMFYTVEVGDTKFT
ILKRYQNLKPIGSGAQGIVCAAYDTATKQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVN
HKNIIGLLNAFTPQRSLEEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKH
LHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG
YKENVDIWSVGCIMGEMIRGGVLFPGSDHIDQWHKIIEQLGTPSQEFMARLQPTVRNYVE
NRPRFPGYPFERLFPDVLFPSDSSEHSRLRASQARDLLSRMLVIDPERRISVDDALLHHY
INIWYDEGEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVMDYETSVSGGGGGGAAVVVV
EDGEEIVDGQRGGARR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggttacgtggggagacagagaggggattttcaaaataaaattaaatgacgcggcgcgg
tgtcccgtgggactccgtttgaaaataattttttccattcaaacggttcgcgaatgcacg
atgacttccagaggaacctccatgttctacacggtggaggttggagacaccaaatttact
atattaaagaggtatcaaaacctcaaaccgatcggatccggggctcaaggaatcgtttgc
gctgcatacgacaccgcgacgaaacaaaatgtggcgataaaaaaattaagccgtcctttt
caaaacgttacgcacgcgaaaagagcgtatagagaatttaagttaatgaaattggtaaac
cacaaaaacataataggtttgctaaatgcgttcacgcctcagagatccctagaagaattt
caagacgtgtacctagtgatggaactcatggacgcaaacttgtgccaagtgatacaaatg
gatttggatcacgagcgtatgtcgtatttattgtatcaaatgctctgcggtatcaagcac
cttcactcggccggaataatacacagagatttaaaaccgagcaacattgtcgtgaaaagc
gattgcacgttgaaaatcctagatttcggactcgctcgaacggctggcacgacgttcatg
atgactccgtacgtcgtcacgagatactatcgtgctcccgaagtcattttgggaatggga
tacaaggaaaatgttgatatatggtccgtcggatgcataatgggtgaaatgataaggggc
ggcgttttgtttcccggatctgatcatattgatcaatggcataaaattatcgaacaatta
ggtacgccgtcgcaagaattcatggcgaggcttcagcccactgtgagaaattacgtggaa
aacaggccgagatttcccgggtatccgttcgaacgactttttcccgacgttttatttccc
tcggattcgtcggaacacagcaggttgagagcgagtcaggcgcgagatcttttatcgcgg
atgttggtcattgatccggagagaagaatatccgtcgacgatgctcttcttcatcattac
ataaacatttggtacgacgagggagaagtgaacgccccggctcccggtccgtacgatcat
tcggtcgacgaaagggaacatacggtcgaacaatggaaagaactcatttaccaagaagtc
atggattacgaaacttccgtgagtggaggaggaggaggaggagccgccgtcgtcgtggta
gaagacggcgaagaaatcgtcgatggtcaacgtggcggagcacgacggtag

DBGET integrated database retrieval system