KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128040Help
Entry
Phum_PHUM128040   CDS       T01223                                 

Definition
(RefSeq) mitogen-activated protein kinase ERK-A, putative
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
phu04068  FoxO signaling pathway
phu04137  Mitophagy - animal
phu04140  Autophagy - animal
phu04141  Protein processing in endoplasmic reticulum
phu04214  Apoptosis - fly
phu04215  Apoptosis - multiple species
phu04310  Wnt signaling pathway
phu04391  Hippo signaling pathway - fly
phu04624  Toll and Imd signaling pathway
phu04933  AGE-RAGE signaling pathway in diabetic complications
Module
phu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM128040
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM128040
   04310 Wnt signaling pathway
    Phum_PHUM128040
   04391 Hippo signaling pathway -fly
    Phum_PHUM128040
   04068 FoxO signaling pathway
    Phum_PHUM128040
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Phum_PHUM128040
   04137 Mitophagy - animal
    Phum_PHUM128040
  Cell growth and death
   04214 Apoptosis - fly
    Phum_PHUM128040
   04215 Apoptosis - multiple species
    Phum_PHUM128040
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Phum_PHUM128040
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Phum_PHUM128040
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Phum_PHUM128040
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Phum_PHUM128040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 8233944
NCBI-ProteinID: XP_002424379
VectorBase: PHUM128040
UniProt: E0VE35
AA seq 436 aa AA seqDB search
MVTWGDREGIFKIKLNDAARCPVGLRLKIIFSIQTVRECTMTSRGTSMFYTVEVGDTKFT
ILKRYQNLKPIGSGAQGIVCAAYDTATKQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVN
HKNIIGLLNAFTPQRSLEEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKH
LHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG
YKENVDIWSVGCIMGEMIRGGVLFPGSDHIDQWHKIIEQLGTPSQEFMARLQPTVRNYVE
NRPRFPGYPFERLFPDVLFPSDSSEHSRLRASQARDLLSRMLVIDPERRISVDDALLHHY
INIWYDEGEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVMDYETSVSGGGGGGAAVVVV
EDGEEIVDGQRGGARR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggttacgtggggagacagagaggggattttcaaaataaaattaaatgacgcggcgcgg
tgtcccgtgggactccgtttgaaaataattttttccattcaaacggttcgcgaatgcacg
atgacttccagaggaacctccatgttctacacggtggaggttggagacaccaaatttact
atattaaagaggtatcaaaacctcaaaccgatcggatccggggctcaaggaatcgtttgc
gctgcatacgacaccgcgacgaaacaaaatgtggcgataaaaaaattaagccgtcctttt
caaaacgttacgcacgcgaaaagagcgtatagagaatttaagttaatgaaattggtaaac
cacaaaaacataataggtttgctaaatgcgttcacgcctcagagatccctagaagaattt
caagacgtgtacctagtgatggaactcatggacgcaaacttgtgccaagtgatacaaatg
gatttggatcacgagcgtatgtcgtatttattgtatcaaatgctctgcggtatcaagcac
cttcactcggccggaataatacacagagatttaaaaccgagcaacattgtcgtgaaaagc
gattgcacgttgaaaatcctagatttcggactcgctcgaacggctggcacgacgttcatg
atgactccgtacgtcgtcacgagatactatcgtgctcccgaagtcattttgggaatggga
tacaaggaaaatgttgatatatggtccgtcggatgcataatgggtgaaatgataaggggc
ggcgttttgtttcccggatctgatcatattgatcaatggcataaaattatcgaacaatta
ggtacgccgtcgcaagaattcatggcgaggcttcagcccactgtgagaaattacgtggaa
aacaggccgagatttcccgggtatccgttcgaacgactttttcccgacgttttatttccc
tcggattcgtcggaacacagcaggttgagagcgagtcaggcgcgagatcttttatcgcgg
atgttggtcattgatccggagagaagaatatccgtcgacgatgctcttcttcatcattac
ataaacatttggtacgacgagggagaagtgaacgccccggctcccggtccgtacgatcat
tcggtcgacgaaagggaacatacggtcgaacaatggaaagaactcatttaccaagaagtc
atggattacgaaacttccgtgagtggaggaggaggaggaggagccgccgtcgtcgtggta
gaagacggcgaagaaatcgtcgatggtcaacgtggcggagcacgacggtag

DBGET integrated database retrieval system