KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128040Help
Entry
Phum_PHUM128040   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM128040
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM128040
   04391 Hippo signaling pathway -fly
    Phum_PHUM128040
   04068 FoxO signaling pathway
    Phum_PHUM128040
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Phum_PHUM128040
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Phum_PHUM128040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MVTWGDREGIFKIKLNDAARCPVGLRLKIIFSIQTVRECTMTSRGTSMFYTVEVGDTKFT
ILKRYQNLKPIGSGAQGIVCAAYDTATKQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVN
HKNIIGLLNAFTPQRSLEEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKH
LHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG
YKENVDIWSVGCIMGEMIRGGVLFPGSDHIDQWHKIIEQLGTPSQEFMARLQPTVRNYVE
NRPRFPGYPFERLFPDVLFPSDSSEHSRLRASQARDLLSRMLVIDPERRISVDDALLHHY
INIWYDEGEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVMDYETSVSGGGGGGAAVVVV
EDGEEIVDGQRGGARR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggttacgtggggagacagagaggggattttcaaaataaaattaaatgacgcggcgcgg
tgtcccgtgggactccgtttgaaaataattttttccattcaaacggttcgcgaatgcacg
atgacttccagaggaacctccatgttctacacggtggaggttggagacaccaaatttact
atattaaagaggtatcaaaacctcaaaccgatcggatccggggctcaaggaatcgtttgc
gctgcatacgacaccgcgacgaaacaaaatgtggcgataaaaaaattaagccgtcctttt
caaaacgttacgcacgcgaaaagagcgtatagagaatttaagttaatgaaattggtaaac
cacaaaaacataataggtttgctaaatgcgttcacgcctcagagatccctagaagaattt
caagacgtgtacctagtgatggaactcatggacgcaaacttgtgccaagtgatacaaatg
gatttggatcacgagcgtatgtcgtatttattgtatcaaatgctctgcggtatcaagcac
cttcactcggccggaataatacacagagatttaaaaccgagcaacattgtcgtgaaaagc
gattgcacgttgaaaatcctagatttcggactcgctcgaacggctggcacgacgttcatg
atgactccgtacgtcgtcacgagatactatcgtgctcccgaagtcattttgggaatggga
tacaaggaaaatgttgatatatggtccgtcggatgcataatgggtgaaatgataaggggc
ggcgttttgtttcccggatctgatcatattgatcaatggcataaaattatcgaacaatta
ggtacgccgtcgcaagaattcatggcgaggcttcagcccactgtgagaaattacgtggaa
aacaggccgagatttcccgggtatccgttcgaacgactttttcccgacgttttatttccc
tcggattcgtcggaacacagcaggttgagagcgagtcaggcgcgagatcttttatcgcgg
atgttggtcattgatccggagagaagaatatccgtcgacgatgctcttcttcatcattac
ataaacatttggtacgacgagggagaagtgaacgccccggctcccggtccgtacgatcat
tcggtcgacgaaagggaacatacggtcgaacaatggaaagaactcatttaccaagaagtc
atggattacgaaacttccgtgagtggaggaggaggaggaggagccgccgtcgtcgtggta
gaagacggcgaagaaatcgtcgatggtcaacgtggcggagcacgacggtag

DBGET integrated database retrieval system