KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128200Help
Entry
Phum_PHUM128200   CDS       T01223                                 

Definition
fatty acid desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:phu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:phu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MSPNGYIDTTKTCSEKPDVEENKEIRNNDGNEFKPVLIWVNIISITILHALAIFSFFKWS
FATKLYTYLWGFLVGFLGGFGVTAGAHRLWTHKSYKAKWPLRLILVICYSIAGQNTLYDW
VRDHRVHHKYSETDADPHNSNRGFFFAHVGWLMQKKHPDVLKKGKLVDMSDLLEDPIVSF
HQRNFTLFKIIFCFLIPIAVPCYFWNESFIISLMGIGCVRYVLGLNFTWLVNSAAHIWGN
RPYDKRISPTENLAVAIASFGEGWHNYHHVFPWDYKAAELGNYKVNITTFGLDMFKKIGW
AYDTKEPSKELIARVSIKYGDGSHKNCPSPHEIDENGEPVNCFEKNHHE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccaacggttacattgatacgacgaaaacatgttcggaaaaaccggatgtggaa
gaaaataaggaaataagaaataacgacggaaatgaattcaaacccgtccttatatgggtt
aatattataagcataaccattttacacgctctcgccattttttcatttttcaaatggagt
tttgcaacaaaattatacacttacctatggggattcctcgttggatttttggggggcttc
ggagtcacggcaggagctcacagattatggacacacaaatcgtacaaagccaaatggcca
ttgagattaatattggtcatttgttattccattgccggccagaatactttatacgattgg
gtaagagatcatagagttcatcataaatacagcgaaactgatgctgatccacataattca
aatcgtggatttttttttgcacacgttggatggttgatgcaaaaaaaacatccggatgta
ttgaaaaaaggaaaattggtagacatgtcggatttgttagaagatccgatagtttcattt
catcaaaggaattttacattattcaaaataattttttgctttttaatacccatagcggta
ccttgttatttttggaacgaatcatttataataagtttaatgggaataggttgcgtacga
tatgttttgggacttaatttcacgtggcttgttaattcagcagctcatatatggggtaac
agaccatatgacaagagaatcagtccgacggaaaatttagccgtggcaatagcctcattc
ggtgaaggatggcacaattaccaccacgttttcccttgggattataaagcagccgaactt
ggaaattataaagttaatataacgacattcggattggacatgtttaaaaaaatcggttgg
gcttacgatacaaaagaaccatcgaaagaactcattgcgagagtcagtattaaatatggc
gacggaagtcataaaaattgtccttccccccacgaaattgatgaaaatggcgaacccgtt
aattgttttgaaaaaaatcaccacgaatga

DBGET integrated database retrieval system