KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128310Help
Entry
Phum_PHUM128310   CDS       T01223                                 

Definition
fatty acid desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Phum_PHUM128310
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Phum_PHUM128310
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Phum_PHUM128310
Lipid biosynthesis proteins [BR:phu01004]
 Desaturase
  First
   Phum_PHUM128310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 379 aa AA seqDB search
MAPNLVSVVPTGTIFENELPTGKKEKVEEEIVNGKSSHKAIVWRNAILFAYLHVAAVYGL
YLAITSAKLYTNLWAYALYVSGGLGITAGAHRLWSHKSYKAKLPLKIFLTICNTIAFQNS
IWEWARDHRVHHKFSETDADPHNAKNGFFFSHVGWLLVKKHPDVRRKGKVIDMSDLDQDP
VVAFQKKYYLILMPIGCFLIPTFVPVYFWGETWSNAWFVATLFRYCFTLNATWLVNSAAH
FFGSKPYDKNMNPAENLMVAVGALGEGWHNYHHVFPWDYKAAELGNYGYNFTTCFIDIMA
KLGQAYDLKTVSPHIVIARAKRTGDGSYVPPENVKIIKEDGHSIDGDVWGWGDKDMKPED
IKAATIINEDKSEERCKTN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaatttggtatccgttgtacctacgggtacaatattcgaaaatgaattaccg
actgggaaaaaggaaaaagtagaagaagagattgtcaatggaaaatcatcacacaaagcc
atagtttggcgtaatgctattttatttgcttatcttcacgttgcagccgtctacggattg
tatttggccataacttctgctaaactctacaccaacttatgggcatatgctttatacgtt
tccggagggttgggaataaccgctggtgcacacagactatggtctcacaaatcttacaaa
gctaaattaccccttaaaatattcctgacgatttgcaacacgatagcatttcaaaattcg
atttgggaatgggcgagagatcacagagtacatcataagttcagcgaaacggatgctgat
ccacacaatgctaaaaatggattctttttttcacacgtcggatggcttcttgttaaaaaa
catccggatgtgaggaggaagggaaaagtgatcgacatgtccgatttggatcaagatccc
gtcgtggcatttcaaaaaaaatattacttgatactcatgccgatcggttgttttttgata
cctacatttgttccggtttatttctggggagaaacatggtcgaacgcttggttcgtagca
actttgttccgttattgtttcacattgaacgccacttggttggtgaatagtgcagctcat
tttttcggttctaaaccatacgataagaacatgaacccggctgaaaatctcatggttgcc
gtgggagctctcggagaaggttggcacaattaccatcacgttttcccctgggattacaaa
gcggccgaattgggaaactacggttacaatttcacgacttgttttatcgacatcatggcc
aaattgggtcaggcttacgatttgaaaactgtttcccctcacatcgtgatagcgagagcc
aaaagaaccggcgatgggtcttacgttccaccggaaaacgttaaaataatcaaagaagac
ggtcattcgattgacggtgacgtttggggatggggagataaagacatgaaaccggaagat
ataaaagcggccaccattatcaatgaagacaagtcggaagaacgttgtaaaacgaattaa

DBGET integrated database retrieval system