KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM128640Help
Entry
Phum_PHUM128640   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 845 aa AA seqDB search
MHVPPTSDSPNFNADLEYLFSGDQNGDVLNSSSPGVCGLCNLGNTCFMNSGLQCLLNTPT
MVQFFMKQVSEDTANPDSLATHFMNLFQKVWSGKYSKVKPTDFHQALGSHHSQFKDYRQH
DCQEFLALVLGSLHELLNTASSATSMNSPINMDDDLEADKQWEKHLGHNQSVIVDSFQGQ
FKSTVVCSECRYVSSTYEPFMYLSVPLPHAMEQQICVTFVPANSNPPTKFLLTLNKQDKI
IKIKEHLRKLMKVNVTMSLELAEVLHHHIARILDENLYIRYLGTSDPYRSIYAFEIPDDV
NATVSSSLSKGDSASLHRSEPLDLTPEQYPVSHALELGSKTVKLNNVETRKMIKQSESDT
TKSNISSTINNNLKEESDLLSSNGRTSIESSPFIGPVFYGPHLEDQGGGDAWVTEKCRPV
DLTSSDKDDWKSCAICLEEVEKGLKNHKGCSCFLCDSCIERSVKHYNEGEENGLMKCPVC
NDLVDPEKAFELVDGNVDFKSSVRMLKIPVLFRLDIEGDGGSSSSEKCQKLFGHPHLIKV
PNRLKGSELYEIVGKLIPYSNFYSIAFVDGQGYHCSRCMYTARCKGCKVSEDAEINLQTG
DNLAVLFTSLVVEIPAIEHHSLKEFRSQEQLSIYDCLDAFSESETLDEHNPWYCPTCQRN
QCATKTLSVWRYPDFLIVYLKRFVFHEYTSVKLDDKVSFPLTGLNLVPPSRIQQGTIRPY
NLYACVNHFGGASAGHYTAYAKNPQSGDWHLFNDETVTAQKPQEDDFCNAYVLFYQKQGT
TLSNLSAFVREKCYLMAPQTLQILSSLKIHSSEVKIQKINSLLRKYFLRLRSRDPSIQYS
SYYRV
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcccacctacatcagatagtcctaatttcaatgctgatcttgaatacttgttt
agtggagatcaaaatggagatgttttaaattcatcttctccgggagtgtgtggactttgc
aatcttggaaatacatgttttatgaattccggtttgcaatgtttgcttaacactccgaca
atggttcagttttttatgaagcaagtatcagaagatactgccaatccagattctttggcc
actcatttcatgaatttatttcaaaaagtttggagtggtaaatacagtaaagtaaaacca
actgatttccatcaagccttgggtagtcatcattcgcagtttaaggattatagacaacat
gattgccaggaatttttagcattagtcttaggtagtcttcacgagcttcttaacacggct
agcagtgcgaccagcatgaacagtccgataaatatggatgatgatttagaagcggataaa
cagtgggaaaagcatttgggacacaatcaaagcgttattgttgattcttttcagggtcaa
tttaaaagcacggttgtttgttccgagtgcagatacgtatcgtctacgtatgagcctttc
atgtatttgtccgtaccgttacctcacgcgatggaacaacaaatatgtgtgacgtttgtt
cccgccaattctaatcctcccacaaaatttttactcacccttaataaacaggacaaaata
attaaaataaaagaacatttgagaaagttgatgaaagttaatgttaccatgtcgctcgaa
ttagccgaagttttacatcatcatattgctagaattttagatgaaaatttgtacattcgt
tatttaggaacgtctgatccatataggagtatttatgcgtttgaaatacctgatgatgtt
aatgcaacagtgtcttcttcgttgtctaaaggcgactctgcgagtttgcacaggagcgaa
cctttagatttaactcccgaacagtatcccgtttctcacgctctagaactcggtagtaag
actgtgaaactaaacaatgtcgaaactcggaaaatgataaagcaaagtgaatccgatacg
acgaaatcaaatatatctagtacaattaataacaatttaaaagaggaatccgatttgttg
tcgtccaacggtcgaacttcaatcgaatcctcgccctttatcggcccagttttctacggg
cctcatttggaagatcagggaggaggggacgcgtgggtaacggaaaaatgtcgtccggtg
gatttgacttcgtcggataaagacgattggaaaagttgcgctatttgtttggaagaagtc
gaaaagggattgaaaaatcacaaaggatgttcctgttttttatgtgatagttgcatcgag
cgatctgttaaacattacaacgagggagaagaaaatggactcatgaaatgtcccgtttgc
aatgatttagtcgatcccgaaaaagctttcgaactcgtcgacggaaatgtggattttaaa
agttccgttaggatgctcaaaattcccgttttgttccgtttggatatcgaaggagacggc
gggagtagtagtagtgagaaatgtcaaaaattattcggacatcctcatttaatcaaagtg
cccaacaggctcaaagggtctgaattatatgaaatcgttggaaaattaattccctatagt
aatttttattccattgcattcgtcgatggacagggttatcattgttctcgttgtatgtac
actgctcgttgcaaaggttgtaaagtatccgaagatgcggagatcaaccttcagaccgga
gacaatttggctgttttattcactagtttagtagttgaaatcccagctatagaacatcat
agtctcaaagaatttagaagtcaagaacaattatcaatatacgattgtttggatgctttt
agcgaaagtgaaactctagatgaacacaatccttggtattgtccaacgtgccaaagaaat
caatgcgcaacaaaaacgctttccgtttggaggtatccggattttttaattgtttatctt
aaaagatttgtttttcacgaatacacgagcgtgaaattagacgataaagtttcttttcca
ttgacgggtttaaatttggtaccgccttctcgaatacaacagggaacaatcagaccgtat
aatttgtacgcatgcgtcaatcatttcggaggggcatctgccggtcactacactgcctac
gccaaaaatccacaatcgggtgattggcatttgttcaacgacgaaacggtaacagcacaa
aaacctcaggaagatgatttttgcaacgcttacgttttattctatcaaaaacaaggaacg
actttatcgaatttatccgctttcgtgcgagaaaaatgttatttaatggcacctcaaacg
ttgcaaatcctttcgtcgttaaaaatacactcgagcgaagttaaaatacaaaaaataaat
tctctgctaaggaagtattttctacgattgagatcaagagatcctagcatccaatattct
agttattatcgtgtatga

DBGET integrated database retrieval system