KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM129510Help
Entry
Phum_PHUM129510   CDS       T01223                                 

Definition
membrane-bound alkaline phosphatase precursor, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Phum_PHUM129510
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Phum_PHUM129510
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM129510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 510 aa AA seqDB search
MSFLIIIFGFITVCQSLPPKNIDSGHYFIKHYDVRKNKFDDFRPEHDAKYWFEKAENDLI
ERLKNFNNVGKRKAKNIILFMGDGMSIPTITSARILQGERNNLTLTETQPLSFENFHVSG
LSKTYCLDHGVADSACSATAYLNGVKADVGTIGVNGRVKYNDVEASANVSNHVNSIAYFA
QKMGKSTGFVTTARVTHASPAGTYAHVANREWESDRAMENYKINSVLYDDIAEQLVLREP
GKNFNVILGGGRKNFLPLKPSRYNKYFEKGNRLDNKNLIQEWINDKKKRNIKNYNYVSSR
KQLATLTTTPSFLLGLFASSHLKYNYENNNKEEPSLEEMTEAAIKVLKKTGSENGFFLFV
EGGKIDIAHHESKAQVALDETIELSKAVAKAVEMTNEEDTLIVVTSDHSHTLTISGYDFG
KEKESLLGFGGTGTDGYVYTTLSYANGPGYSERKDLSKEDTRKIDYLFPGTVPLQSETHG
GDDVAVFATGPYSQLFTGTYEQSYIPHAMA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttaataattatttttggttttatcaccgtttgtcaatcacttccgcccaag
aatatcgattccggccattattttataaaacattatgacgtaagaaaaaataaatttgat
gattttcgaccggaacacgatgctaaatattggtttgaaaaagcagaaaacgatttgata
gaaagattaaaaaattttaacaatgtcggaaagagaaaagctaaaaacataatacttttc
atgggtgatggaatgtcgataccgacgataacctcagcgagaattcttcaaggagaaaga
aataatttaacactgaccgaaacgcaacctttgagttttgaaaatttccacgttagcgga
ctatctaaaacttactgtttggatcacggcgttgctgattcagcatgcagtgcaacagcg
tatttgaatggtgtcaaagccgacgtgggtactatcggtgtcaacggtagagtgaaatac
aatgatgtcgaagcttctgcaaatgttagcaatcacgttaattcgatagcttactttgca
caaaaaatggggaaatccactggattcgtgactacggcaagagtgactcacgcatctccc
gctggaacatatgctcacgttgccaatcgcgaatgggaatccgacagagccatggaaaat
tataaaattaattccgttctttacgatgacatcgccgaacaacttgtcctacgggaacct
ggaaaaaatttcaacgtcattttgggagggggaagaaaaaattttctacccttaaaaccg
tcaagatataacaaatatttcgaaaagggtaatcgtttggacaacaagaatttaattcaa
gaatggataaacgataaaaaaaaaagaaatattaaaaattataattacgtgtcgagtaga
aaacaattggcaacactgacgacgactccatcttttcttttaggtttatttgcttcgagt
cacttgaaatacaattacgaaaataataataaagaagaaccaagtctggaagaaatgacg
gaagcggccatcaaagttttaaagaaaaccggaagtgaaaatggttttttccttttcgtc
gaaggtggaaaaattgacatagctcatcacgaaagcaaggctcaagttgcactcgatgaa
acaattgaattatcaaaagctgttgcgaaagctgtagaaatgacaaacgaagaagatact
ttgatagtcgtcacttccgatcactcgcacacgttgaccataagcggttatgattttgga
aaagaaaaagaaagccttttaggtttcggtggtacaggtaccgatggatatgtttacacg
actttgagttatgcaaacggacctggttattctgaaagaaaagatctgagtaaagaagat
acaagaaaaattgattatttatttcctggtacggttccattacaatctgaaactcatggc
ggtgatgatgttgccgtttttgccactggtccttattcacaattatttaccggtacctac
gaacaatcttacataccacatgcaatggcgtaa

DBGET integrated database retrieval system