KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM145610Help
Entry
Phum_PHUM145610   CDS       T01223                                 

Definition
elongator complex protein, putative (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM145610
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Phum_PHUM145610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 532 aa AA seqDB search
MVLTIGEIIQELIRAHDEKKDVNLNHIKTKISSKYGLDSQPRLVDIISAVPPQHRKNLVP
KLKAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTS
MRAIRANYNPYLQTRHRVEQLQQLGHSVDKVEFIVMGGTFMSLPADYRDYFIRNLHDALT
GHSSSNVEEAVKHSERSKIKCIGITIETRPDYCLKRHLSDMLGYGCTRLEIGVQSVYEDV
ARDTNRGHTVRAVCESFNLAKDAGFKVVAHMMPDLPNVDLERDLEQFIEFFENPAFRADG
LKIYPTLVIRGTGLYELWKTGRYKSYPPNTLVDLIARILALIPPWTRVYRVQRDIPMPLV
SSGVEHGNLRELALLRMKDLGTQCRDVRTREVGIQEIHNKVKPYEVELVRRDYFANGGWE
TFLSYEDPEQDILVGLLRLRKCSEDTFRPELKGKSSIVRELHVYGSVVAVSARDPTKFQH
QGFGMLLMEEAERIAKEEHGSEKIAVISGVGTRNYYRKLGYELDGPYMSKSL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggttttaacaattggtgaaatcattcaagaactcattcgagctcacgatgaaaaaaaa
gatgttaatctaaatcacataaaaactaaaatttcttccaaatacggtcttgattctcag
cctcgattagttgacattatatcggccgtacctccacaacatagaaaaaatttagtacca
aaactaaaagcaaaaccaattagaactgcaagtggaattgctgttgtagctgtcatgtgt
aagccacacagatgtccacacattaacatgactggaaacatttgtgtttattgcccaggt
ggaccagattccgattttgaatattctacccaatcttacactggttacgagcctacatca
atgagagccattagagcaaactataatccttacttacaaacaagacacagagttgaacag
ctgcaacaattaggtcattcagttgataaagttgagtttatagttatgggaggaactttt
atgagccttcctgctgattatagagattattttattaggaatttacatgatgctttgaca
ggtcattcaagcagtaatgtagaagaagctgtaaagcactctgaaagaagtaaaataaaa
tgtattggaataactatagaaacaagacctgattattgcttgaaacgtcatctttccgat
atgctcggttatgggtgtaccagattagaaataggagttcaatctgtatatgaagatgtt
gctagagatacaaataggggccacactgtaagagcagtttgtgaaagtttcaacttggct
aaagatgctggatttaaagtagttgctcatatgatgcctgatttgcctaatgtcgacttg
gaaagagatttggaacaatttattgaattttttgagaatccagcttttcgagctgatgga
ttaaaaatttatccaactcttgtcataagaggtactggtttatatgaattatggaaaaca
ggaaggtacaaaagttatcctccgaatactttagtagatctaattgctagaattttagct
cttatacctccttggacaagagtttacagagtgcagcgtgatatacccatgcccttagtg
agttctggagtggaacatggtaacttgcgagaattggcattattacgaatgaaagattta
ggaactcaatgtagagacgttagaacgcgtgaagttggaattcaagaaattcataataaa
gtaaaaccttacgaggtagagttagtgagacgtgattacttcgcgaacggcggttgggaa
acgtttttatcttacgaagatcccgaacaagatattctcgttggtcttttacgattacga
aaatgttccgaagatacctttagaccagaattaaagggaaaaagttcgatcgttcgagaa
cttcacgtttacgggagcgttgtggcagtcagcgcaagggatccgacaaagtttcaacat
caaggctttggcatgttgctaatggaagaagcagaaaggatagcaaaagaagaacatgga
tctgaaaaaatagctgttatatccggagtaggaacaagaaactattataggaagttggga
tatgagttggatggtccttacatgtcaaaaagtctttag

DBGET integrated database retrieval system