KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM148630Help
Entry
Phum_PHUM148630   CDS       T01223                                 

Definition
Profilin, putative
Orthology
K05759  
profilin
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Exosome [BR:phu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Phum_PHUM148630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVEKQLLASKCVTKAAIVGHDGNVWAKSEGFELSKDELTKLVQSFDKQDILTSTG
VTLAGTRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY
LVGCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaggattatgtagagaagcaattacttgcttctaaatgtgtaacaaaagct
gcaatcgttggacacgatggcaatgtttgggctaaatctgaaggatttgaattgtcgaaa
gatgaattgaccaaattggtacaaagtttcgataaacaagatattttaacttcaaccggt
gtaacgctagcaggcacgcgctacatctacctatcaggaacagatagagttatccgggcg
aagcttggaaaagtaggagtacattgcatgaaaacaacgcaagccgttgtcgtttcttta
tatgaagatccaattcagccgcaacaagcggcgtccgtagtggaaaagttaggagattac
ttagttggttgcggttattag

DBGET integrated database retrieval system