KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM157790Help
Entry
Phum_PHUM157790   CDS       T01223                                 

Definition
Chitooligosaccharidolytic beta-N-acetylglucosaminidase precursor, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:phu00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:phu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:phu00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:phu00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:phu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:phu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MVYGKNIKPGQETNSVTSKKVTTGSSKMITPEERIDELIIEIQDRIEFLNDMEGLGKRKE
YEFTMKQEIAAKLREIEKLDPTIAKKYFKKKKMYFFNLLTLIIVFVVVAPTQLIRGTWNC
YDNKCVKEEIDLFEKSISIQECKVKCLKYGGLWPKPTGPFYVGNTTSQINVDKIHFEYQN
EVPTSVSTLLTKAQNRFLYKIKKIGGEKEIKNVLFDVYIQFHIVDTNVTVFSTNVDESYK
IQIIPPTSLNKVQITIEANNYLGARHGLETLSQLIFYDDIHKTYKMVDEATIFDRPIFTH
RGILLDTARSFISTENILKILDIMAMDKLNTFHWHITDSQSFPYVSLAYPELSQNGAYSE
NQVYTQDDIKKIVSHGQSLGIRVLPEFDAPAHVGEGWSALGSDLITCFKWQPWRKYCVEP
PCGQLDPTNEKVYEILGTIFKEYVDLFQSDLFHLGGDEVNINCWNSTTRIKQWMVNHKYP
LTDSGYVKLWSEYQYKALQKLRQTKKDVHPQGILWTSTLTNPENIGKYIRPEDYIIQVWT
LKTDQTIKSLLNNKFKIILSNYDELYFDCGGPGWVKSAEQNWCSPYISWRKVYKHSPYQI
AKNLGIQLNEENKKLILGKQIDNHNVIHRLWPRTSALAERLWSNPSGDWIDAQFRMNHHR
ERLSNEGPTELLQPQWCYQNDGFCD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggtttatggtaaaaatataaaacctggacaggaaacgaatagcgttacatcaaaaaaa
gtaactaccggaagttcaaaaatgataactccggaagaacgtatcgatgaactcattatt
gaaatacaagatagaattgaatttttgaatgatatggaaggtcttggtaaaagaaaagaa
tatgaattcacgatgaaacaagaaattgctgcgaaacttcgagaaatagaaaaactagat
ccaactattgctaaaaaatactttaaaaaaaaaaaaatgtattttttcaatttgttaaca
ttgataattgtatttgttgtcgtggctcccacgcaattaataagagggacgtggaattgc
tacgataataaatgtgtaaaagaagaaattgatttatttgaaaaatcaattagtattcaa
gaatgtaaagtaaaatgtctcaaatatggaggattgtggccaaagccaacaggcccattt
tatgtaggcaatacaacatctcaaataaatgttgataaaatacattttgaatatcaaaat
gaagtaccaacaagtgtgtctactttattgaccaaagcacaaaatcgttttttgtataaa
ataaaaaaaattggtggagaaaaagaaattaaaaatgttttatttgatgtttatatacaa
tttcatatagttgatacaaacgtaacggttttttctacaaatgtcgacgaaagttataaa
attcaaataatcccaccgacaagtttaaataaagttcaaattacaattgaagctaataat
tatttaggagcacgacatggattagaaacgttaagtcaattaattttttatgatgatata
cataaaacatacaaaatggtcgatgaagccactatatttgatagaccaatatttacacac
agaggaatattattagatacagctagatcttttatatcaacggaaaatattttaaaaatt
ttagacattatggctatggataaattaaatacatttcattggcacataactgattctcaa
agttttccatatgtttctttagcttatccagaattaagtcaaaatggagcttattcggaa
aatcaagtttacacccaagatgatataaaaaaaatagtgagtcatggtcaaagtttagga
ataagagttcttccagaattcgatgctccagcacacgttggtgaaggatggtcagcatta
ggatcagatctgataacttgttttaaatggcagccatggagaaaatactgtgtggaacct
ccatgtggacaacttgatcccacaaatgaaaaagtctatgaaatattgggaacaattttt
aaagaatatgttgatttatttcaatcagatttgtttcatttaggaggagatgaggtaaat
ataaattgttggaattcaacaaccagaattaaacaatggatggtaaatcataaatatcct
ctaactgattcaggatatgtcaaactttggagcgaatatcaatataaagcattacaaaaa
ttaagacaaactaaaaaagatgttcatcctcaaggaattttgtggactagcactttaaca
aatccagaaaatattggtaaatacatacgtccagaagattacataattcaagtatggaca
ttaaaaactgatcaaacaataaaatccttattgaataataaatttaaaataatattatca
aattatgatgaactttattttgattgcggaggaccaggatgggttaaaagtgctgaacaa
aattggtgttctccttacattagttggagaaaggtgtacaaacattcaccataccaaatt
gctaaaaatttaggaattcaattaaatgaagaaaataaaaaattaattttgggcaaacaa
attgataatcataacgtaatacatcgattatggcccagaacttcggctttagcagaacgt
ttatggtcgaatccttcaggagattggattgatgcacaatttagaatgaaccaccacaga
gaaagactttctaatgaaggtccaacagaattacttcaacctcaatggtgttatcaaaat
gatggattttgtgattga

DBGET integrated database retrieval system