KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM157790Help
Entry
Phum_PHUM157790   CDS       T01223                                 

Definition
(RefSeq) Chitooligosaccharidolytic beta-N-acetylglucosaminidase precursor, putative
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00511  Other glycan degradation
phu00520  Amino sugar and nucleotide sugar metabolism
phu00531  Glycosaminoglycan degradation
phu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
phu00604  Glycosphingolipid biosynthesis - ganglio series
phu01100  Metabolic pathways
phu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM157790
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Phum_PHUM157790
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Phum_PHUM157790
   00604 Glycosphingolipid biosynthesis - ganglio series
    Phum_PHUM157790
   00511 Other glycan degradation
    Phum_PHUM157790
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Phum_PHUM157790
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Phum_PHUM157790
Chaperones and folding catalysts [BR:phu03110]
 Intramolecular chaperones
  Others
   Phum_PHUM157790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 UPF0193 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 8236531
NCBI-ProteinID: XP_002424880
VectorBase: PHUM157790
UniProt: E0VFI6
AA seq 685 aa AA seqDB search
MVYGKNIKPGQETNSVTSKKVTTGSSKMITPEERIDELIIEIQDRIEFLNDMEGLGKRKE
YEFTMKQEIAAKLREIEKLDPTIAKKYFKKKKMYFFNLLTLIIVFVVVAPTQLIRGTWNC
YDNKCVKEEIDLFEKSISIQECKVKCLKYGGLWPKPTGPFYVGNTTSQINVDKIHFEYQN
EVPTSVSTLLTKAQNRFLYKIKKIGGEKEIKNVLFDVYIQFHIVDTNVTVFSTNVDESYK
IQIIPPTSLNKVQITIEANNYLGARHGLETLSQLIFYDDIHKTYKMVDEATIFDRPIFTH
RGILLDTARSFISTENILKILDIMAMDKLNTFHWHITDSQSFPYVSLAYPELSQNGAYSE
NQVYTQDDIKKIVSHGQSLGIRVLPEFDAPAHVGEGWSALGSDLITCFKWQPWRKYCVEP
PCGQLDPTNEKVYEILGTIFKEYVDLFQSDLFHLGGDEVNINCWNSTTRIKQWMVNHKYP
LTDSGYVKLWSEYQYKALQKLRQTKKDVHPQGILWTSTLTNPENIGKYIRPEDYIIQVWT
LKTDQTIKSLLNNKFKIILSNYDELYFDCGGPGWVKSAEQNWCSPYISWRKVYKHSPYQI
AKNLGIQLNEENKKLILGKQIDNHNVIHRLWPRTSALAERLWSNPSGDWIDAQFRMNHHR
ERLSNEGPTELLQPQWCYQNDGFCD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggtttatggtaaaaatataaaacctggacaggaaacgaatagcgttacatcaaaaaaa
gtaactaccggaagttcaaaaatgataactccggaagaacgtatcgatgaactcattatt
gaaatacaagatagaattgaatttttgaatgatatggaaggtcttggtaaaagaaaagaa
tatgaattcacgatgaaacaagaaattgctgcgaaacttcgagaaatagaaaaactagat
ccaactattgctaaaaaatactttaaaaaaaaaaaaatgtattttttcaatttgttaaca
ttgataattgtatttgttgtcgtggctcccacgcaattaataagagggacgtggaattgc
tacgataataaatgtgtaaaagaagaaattgatttatttgaaaaatcaattagtattcaa
gaatgtaaagtaaaatgtctcaaatatggaggattgtggccaaagccaacaggcccattt
tatgtaggcaatacaacatctcaaataaatgttgataaaatacattttgaatatcaaaat
gaagtaccaacaagtgtgtctactttattgaccaaagcacaaaatcgttttttgtataaa
ataaaaaaaattggtggagaaaaagaaattaaaaatgttttatttgatgtttatatacaa
tttcatatagttgatacaaacgtaacggttttttctacaaatgtcgacgaaagttataaa
attcaaataatcccaccgacaagtttaaataaagttcaaattacaattgaagctaataat
tatttaggagcacgacatggattagaaacgttaagtcaattaattttttatgatgatata
cataaaacatacaaaatggtcgatgaagccactatatttgatagaccaatatttacacac
agaggaatattattagatacagctagatcttttatatcaacggaaaatattttaaaaatt
ttagacattatggctatggataaattaaatacatttcattggcacataactgattctcaa
agttttccatatgtttctttagcttatccagaattaagtcaaaatggagcttattcggaa
aatcaagtttacacccaagatgatataaaaaaaatagtgagtcatggtcaaagtttagga
ataagagttcttccagaattcgatgctccagcacacgttggtgaaggatggtcagcatta
ggatcagatctgataacttgttttaaatggcagccatggagaaaatactgtgtggaacct
ccatgtggacaacttgatcccacaaatgaaaaagtctatgaaatattgggaacaattttt
aaagaatatgttgatttatttcaatcagatttgtttcatttaggaggagatgaggtaaat
ataaattgttggaattcaacaaccagaattaaacaatggatggtaaatcataaatatcct
ctaactgattcaggatatgtcaaactttggagcgaatatcaatataaagcattacaaaaa
ttaagacaaactaaaaaagatgttcatcctcaaggaattttgtggactagcactttaaca
aatccagaaaatattggtaaatacatacgtccagaagattacataattcaagtatggaca
ttaaaaactgatcaaacaataaaatccttattgaataataaatttaaaataatattatca
aattatgatgaactttattttgattgcggaggaccaggatgggttaaaagtgctgaacaa
aattggtgttctccttacattagttggagaaaggtgtacaaacattcaccataccaaatt
gctaaaaatttaggaattcaattaaatgaagaaaataaaaaattaattttgggcaaacaa
attgataatcataacgtaatacatcgattatggcccagaacttcggctttagcagaacgt
ttatggtcgaatccttcaggagattggattgatgcacaatttagaatgaaccaccacaga
gaaagactttctaatgaaggtccaacagaattacttcaacctcaatggtgttatcaaaat
gatggattttgtgattga

DBGET integrated database retrieval system