KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM157790Help
Entry
Phum_PHUM157790   CDS       T01223                                 

Definition
Chitooligosaccharidolytic beta-N-acetylglucosaminidase precursor, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM157790
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Phum_PHUM157790
   00603 Glycosphingolipid biosynthesis - globo series
    Phum_PHUM157790
   00604 Glycosphingolipid biosynthesis - ganglio series
    Phum_PHUM157790
   00511 Other glycan degradation
    Phum_PHUM157790
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Phum_PHUM157790
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Phum_PHUM157790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MVYGKNIKPGQETNSVTSKKVTTGSSKMITPEERIDELIIEIQDRIEFLNDMEGLGKRKE
YEFTMKQEIAAKLREIEKLDPTIAKKYFKKKKMYFFNLLTLIIVFVVVAPTQLIRGTWNC
YDNKCVKEEIDLFEKSISIQECKVKCLKYGGLWPKPTGPFYVGNTTSQINVDKIHFEYQN
EVPTSVSTLLTKAQNRFLYKIKKIGGEKEIKNVLFDVYIQFHIVDTNVTVFSTNVDESYK
IQIIPPTSLNKVQITIEANNYLGARHGLETLSQLIFYDDIHKTYKMVDEATIFDRPIFTH
RGILLDTARSFISTENILKILDIMAMDKLNTFHWHITDSQSFPYVSLAYPELSQNGAYSE
NQVYTQDDIKKIVSHGQSLGIRVLPEFDAPAHVGEGWSALGSDLITCFKWQPWRKYCVEP
PCGQLDPTNEKVYEILGTIFKEYVDLFQSDLFHLGGDEVNINCWNSTTRIKQWMVNHKYP
LTDSGYVKLWSEYQYKALQKLRQTKKDVHPQGILWTSTLTNPENIGKYIRPEDYIIQVWT
LKTDQTIKSLLNNKFKIILSNYDELYFDCGGPGWVKSAEQNWCSPYISWRKVYKHSPYQI
AKNLGIQLNEENKKLILGKQIDNHNVIHRLWPRTSALAERLWSNPSGDWIDAQFRMNHHR
ERLSNEGPTELLQPQWCYQNDGFCD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggtttatggtaaaaatataaaacctggacaggaaacgaatagcgttacatcaaaaaaa
gtaactaccggaagttcaaaaatgataactccggaagaacgtatcgatgaactcattatt
gaaatacaagatagaattgaatttttgaatgatatggaaggtcttggtaaaagaaaagaa
tatgaattcacgatgaaacaagaaattgctgcgaaacttcgagaaatagaaaaactagat
ccaactattgctaaaaaatactttaaaaaaaaaaaaatgtattttttcaatttgttaaca
ttgataattgtatttgttgtcgtggctcccacgcaattaataagagggacgtggaattgc
tacgataataaatgtgtaaaagaagaaattgatttatttgaaaaatcaattagtattcaa
gaatgtaaagtaaaatgtctcaaatatggaggattgtggccaaagccaacaggcccattt
tatgtaggcaatacaacatctcaaataaatgttgataaaatacattttgaatatcaaaat
gaagtaccaacaagtgtgtctactttattgaccaaagcacaaaatcgttttttgtataaa
ataaaaaaaattggtggagaaaaagaaattaaaaatgttttatttgatgtttatatacaa
tttcatatagttgatacaaacgtaacggttttttctacaaatgtcgacgaaagttataaa
attcaaataatcccaccgacaagtttaaataaagttcaaattacaattgaagctaataat
tatttaggagcacgacatggattagaaacgttaagtcaattaattttttatgatgatata
cataaaacatacaaaatggtcgatgaagccactatatttgatagaccaatatttacacac
agaggaatattattagatacagctagatcttttatatcaacggaaaatattttaaaaatt
ttagacattatggctatggataaattaaatacatttcattggcacataactgattctcaa
agttttccatatgtttctttagcttatccagaattaagtcaaaatggagcttattcggaa
aatcaagtttacacccaagatgatataaaaaaaatagtgagtcatggtcaaagtttagga
ataagagttcttccagaattcgatgctccagcacacgttggtgaaggatggtcagcatta
ggatcagatctgataacttgttttaaatggcagccatggagaaaatactgtgtggaacct
ccatgtggacaacttgatcccacaaatgaaaaagtctatgaaatattgggaacaattttt
aaagaatatgttgatttatttcaatcagatttgtttcatttaggaggagatgaggtaaat
ataaattgttggaattcaacaaccagaattaaacaatggatggtaaatcataaatatcct
ctaactgattcaggatatgtcaaactttggagcgaatatcaatataaagcattacaaaaa
ttaagacaaactaaaaaagatgttcatcctcaaggaattttgtggactagcactttaaca
aatccagaaaatattggtaaatacatacgtccagaagattacataattcaagtatggaca
ttaaaaactgatcaaacaataaaatccttattgaataataaatttaaaataatattatca
aattatgatgaactttattttgattgcggaggaccaggatgggttaaaagtgctgaacaa
aattggtgttctccttacattagttggagaaaggtgtacaaacattcaccataccaaatt
gctaaaaatttaggaattcaattaaatgaagaaaataaaaaattaattttgggcaaacaa
attgataatcataacgtaatacatcgattatggcccagaacttcggctttagcagaacgt
ttatggtcgaatccttcaggagattggattgatgcacaatttagaatgaaccaccacaga
gaaagactttctaatgaaggtccaacagaattacttcaacctcaatggtgttatcaaaat
gatggattttgtgattga

DBGET integrated database retrieval system