KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM158460Help
Entry
Phum_PHUM158460   CDS       T01223                                 

Definition
histone deacetylase RPD3, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Phum_PHUM158460
Enzymes [BR:phu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Phum_PHUM158460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 340 aa AA seqDB search
MLYSLGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATQEEMTKFHSDD
YIRFLRSIRPDNMSEYNKQMQRLEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGK
YYAVNIPLRDGMDDESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRG
HGKCVEFVKKYGMPFLMVGGGGYTIRNVSRCWTYETSVALGTEIANELPYNDYFEYFGPD
FKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGVHESEEDEDKVN
PDERLPQSEKDMTKKMLSEVEKEDRTVPVEDLKKDNESNP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctttactctttaggtgacataggaaattattactatggtcaaggacatcctatgaag
cctcacagaatacgaatgactcataatttacttctcaactatggactttatagaaaaatg
gaaatttataggccacataaagctactcaagaagaaatgacaaaatttcacagcgatgat
tatattcgatttttaagaagtataaggcctgacaatatgagcgaatataataagcaaatg
caaaggttggaagaagctttttatacaactgatagagttatgactgtttcttttcataag
tacggcgaatattttcctggcactggagatcttagagatattggagctggtaaaggtaaa
tattacgccgtgaatattcctcttcgtgacggaatggatgacgaatcttacgaaagtatt
ttcgttccaataattagtaaagtaatggaaacttttcaaccaagtgcggttgtacttcaa
tgtggagctgactctttaacaggagaccgtttaggttgctttaatttaaccgttcggggt
catgggaaatgcgttgaatttgtcaaaaaatacggtatgccatttttaatggtaggagga
ggaggatataccattcgtaatgtttcaagatgttggacctatgaaacctccgttgctttg
ggaactgaaattgccaacgaacttccttataatgattattttgaatactttggcccagat
ttcaaattacacataagtccatcaaacatggcgaatcagaacactcctgaatatttggaa
aaaattaaaacaagattatttgaaaatttaagaatgttgccgcacgcaccaggagttcaa
gtacaagccatacccgaggatggagtgcacgaatcagaagaagatgaggataaagttaat
ccagatgaaaggctacctcaatccgaaaaggacatgacaaaaaaaatgttatcagaagtt
gaaaaggaggatcgaacagttccagtagaagaccttaagaaagacaacgaatcaaatcct
tga

DBGET integrated database retrieval system