KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM169870Help
Entry
Phum_PHUM169870   CDS       T01223                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 811 aa AA seqDB search
MVQSEFLLPHLSNVRIPNKHDKIYKDECLLSYDTPESETGLYISLTSFMGFGKDYVDLYY
NKTKHAVFLHYLRTKTELPSDHQGDAGGPDKKITRLAIGLEGGFDVDADKKKYTFIDNYS
IVILPNYETISIRDPNLPEIIKIAAQEIIDATSALKMAELSALTGTWDGEQRFVTKHASN
LVQLNNGKKIPLSGWKCEKCDLTQNLWLNLTDGAILCGRKYHDGSGGNNHAVQHSKETGY
PLAVKLGTITKEGKGDVYSYDESENDMVDNPYLIQHLLHFGIDVSQLEKTEKTMVELELD
LNQKIGEWSICQELGSTLIPAYGPGRTGMVNLGNSCYLNSVMQVIFSIPGFIRRFVDESP
KIMESLDYFDDPAYNFVVQMSKLGFGLCSGKYSQPPPDNVEDKEQKGISPKMFKTIIGLE
NRDFASNQQQDAQEFFLHLINMLERHTHPDQNPSDCFKFQVEDKFQCNESKKVKYLYRNE
YCLPIPIPVEKAINKTEVLEYERKKGEALAKGQKLDPDAIVRPCITFSSCIKAFSQPEII
EKFYSSAINGETTASKTTRLSSFPEYLLLHLKKFFVNSEYQASKLDVAVEMPDTLDLSEI
KGCGQQPNEELLPDVVENPPQPVLDEQVLSKLLILGFNVEGAKRAVYFTTKNNISTEQHL
EDSMEWIKVHMKDPDFENPFVPPGISSNQTPFKPDETSISQIMDMGFTREQAMRALKKTN
NNIDAACDWILEHFDDVISQPESSDRNSTCYKLRAFISHMGTSSMVGHYVCHILKDGQWI
IYNDNKVALSECPPKELGYLYLYEQIKSSPQ
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaagtgagtttttattaccacatttgagtaatgttagaattccaaataagcac
gataaaatatataaagatgaatgcttattgtcttacgatacgcctgaaagtgaaaccgga
ttatatatcagcttaactagtttcatgggatttggaaaagattatgttgatctttattat
aataaaaccaaacatgcagttttccttcattatttaagaactaaaacagaattgccttct
gatcatcagggagatgcaggaggtccagacaaaaaaattactaggcttgctataggtttg
gaaggaggttttgatgttgatgctgacaaaaaaaagtacacttttattgataattattcg
attgttattttaccaaattatgaaaccatatcaattagagatcctaacttaccagaaata
ataaaaatagcagctcaagaaattattgatgccacttcagctttaaaaatggctgaacta
tcagctttaaccgggacatgggatggagaacaaagatttgttactaagcatgcaagtaat
ttagttcaactgaataatgggaaaaaaattccgttatcaggttggaaatgtgaaaaatgt
gatttaactcaaaatttatggcttaatttgactgatggtgcaatcctttgtggtaggaaa
taccatgatggttctggtggaaacaatcatgcagtacaacattcaaaagaaacaggatac
ccattagctgtgaaattgggaacaataacaaaagaaggaaaaggtgatgtttacagttat
gatgaatcagaaaatgatatggttgataatccttatttaatacaacatttattgcatttt
ggaattgatgtttctcaactcgaaaagacagaaaaaacaatggtagaattagaacttgat
ttaaatcaaaaaattggcgaatggagtatttgtcaagaattaggaagcactcttatacct
gcatatggaccaggaagaacaggaatggtaaatttaggaaattcctgttatctcaatagt
gtaatgcaggttatttttagtattcctggatttataagaagatttgtcgatgaatctcct
aaaattatggaatctttagattatttcgatgatcccgcctataatttcgtagttcaaatg
tctaaattaggttttggactttgttctggaaaatattctcaacctcctccggataatgtt
gaagataaagagcaaaaaggaataagtcctaaaatgtttaaaactataatcggattggaa
aatagagattttgccagcaatcaacaacaggatgcccaagaatttttccttcatttaatt
aacatgttagagagacatactcatccggatcaaaatccctctgactgtttcaagtttcaa
gtcgaagataaatttcaatgtaatgaaagcaaaaaagtcaaatatttatacaggaatgaa
tactgccttcctattcctataccagtagaaaaagcaattaataaaacggaagtattagag
tatgaaaggaaaaaaggagaggctcttgccaagggtcaaaaattggatcccgatgccata
gtccgtccttgcataactttttcatcttgcattaaagccttttctcaaccggagattatt
gaaaaattttattcgtcggccataaatggagaaacgaccgcttcgaaaacaactagatta
agctcttttccggaatatttgttactccatttaaaaaaattttttgtaaatagcgaatat
caagcttcgaaattagacgtggcagtagaaatgccggatacgttagatctttccgaaatc
aaaggctgtggacaacaaccgaacgaagaacttttaccggatgtcgttgaaaatcctccc
caacccgttctcgatgaacaagtattaagtaaattattaatattgggttttaacgtggaa
ggagctaaaagagccgtgtattttacaacgaaaaataatattagcacagaacaacattta
gaagattcaatggaatggattaaagttcatatgaaggatcccgattttgaaaatccattc
gtgccacctggaatttcgtcgaatcaaacgccatttaaacctgatgaaacttcaattagc
caaataatggacatgggattcactcgagagcaagcaatgagagcattaaaaaaaactaat
aataatatcgatgcagcttgcgattggatattagaacattttgacgatgttattagtcaa
ccggaatcgagcgatcgaaatagcacttgttataaacttcgcgctttcatatctcacatg
ggtacgtcatcgatggtgggacactacgtttgtcacattctcaaagatggacagtggatc
atttacaacgacaataaagttgctctctcggaatgtcctccgaaagaactcggatacctg
tatttgtacgaacaaatcaaatcatcaccgcaataa

DBGET integrated database retrieval system