KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM169940Help
Entry
Phum_PHUM169940   CDS       T01223                                 

Definition
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform, putative (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Phum_PHUM169940
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Phum_PHUM169940
   04068 FoxO signaling pathway
    Phum_PHUM169940
   04070 Phosphatidylinositol signaling system
    Phum_PHUM169940
   04150 mTOR signaling pathway
    Phum_PHUM169940
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Phum_PHUM169940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1069 aa AA seqDB search
MVHIPSPYAFDYWLREPTSSQVELSCLMPNGIFIPLPANRNAILLEIKEELWEEASKYPF
PGILRDASSYIFSCISTMGETEELRDENRRLCDIRPFCSVLKVIEKKKGDGDGDEKALNF
QISSLIGKGLHEFEALKNPEVNDFRWKMKLLGSEVARSRQNKSWLEKIAYQFPPRLASSS
AIPASCLARMREGSYFVIVSKFQNTDSAFKFNISYSTTPIQLLQLILNKKSITLNTKGEH
PSEFMLKVCGQEEYLIGGYPLVRFLYIQECLSREVTPTVVVIIMIKLNFLVDQDNVYENL
DDLDLSASRQTFSTLTLRKNKGKYLSSWTIDDRFSLKICAISRLNTDVNRTVGIQVGIFH
GGKPLCESQKTSEKAVLKDGKVDFEEELTFDIQISNIPRMARLCFAVYEISKSAKGVKAK
KVKDSKQDLYMNPLTWVNTTVYDFKNQLKTGDITLYMWTYAEDSQHEEMLQSLGTVVSNT
NVDHATALTLSFKSYSTEHTIIYPSVEKMIEHAEKYFDPCSVANFSPQDVKTYLENVRQL
AESDPLRDMHEQDLKELWALRYEAQKYVPTLLAKLLDTVEWNNRNEVAEAISLLQKWPRL
PVEKALELLDYAYADQQVRSFAVKCLQSVSDEELSLYLLQLVQALKHESYLSCDLVEFLL
RRALNNRKIGHFLFWHLKSEMTVPCVSIRFGLILEAYCRGSQKHMDILSKQLDYLNKMKE
TSELLRQRKDRDKARQWLHERLGESHCLEALSDVVNPLNPRFKMKKIKVEKCRVMDSKMR
PLYLVMENDDPYGDDVYIIFKNGDDLRQDMLALQMIKIMDMLWKNEGLDLRMNPYGCVST
EHRVGLIEVVLNAETIANIQKEKGMFSATSAFSKGSLLAWLKDYNPEENQLLKAIEEFTL
SCAGYCVATYVLGVADRHSDNIMVKKSGQLFHVDFGHILGHFKEKFGFRRERVPFVLTHD
FVHVINKGQKDKKEALEFQIFQNHCEKAFLILRRHGSLILSLFAMMISTGLPELSSEKDL
NYLRETLVLDLSENEALLHFRSKFCEALANSWKTSLNWASHNLAKNNKQ
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacataccatcaccatatgcatttgattactggttgagagaaccgaccagtagt
caagttgaacttagttgccttatgccaaatggaattttcattcctcttccagctaatcga
aatgcaatattgttggaaatcaaagaggaattatgggaagaagcaagcaagtatcctttt
ccaggaattttgagagatgcttcctcttatattttctcatgtattagtacaatgggagaa
acggaagaattacgtgatgaaaatagacgtctctgtgatattaggccattttgttctgtt
ctgaaagtcatagagaagaaaaaaggagatggtgatggagatgaaaaggctttaaatttt
caaattagttctttaattggaaaaggtcttcatgagtttgaagcattaaaaaatccagag
gtgaatgattttcgatggaaaatgaaacttctcggttctgaagttgctagaagtaggcaa
aacaaatcttggttggaaaaaatagcttatcaatttcccccaagactggcatcttcttca
gcaattcccgctagttgtttagcaagaatgagagaaggaagttattttgttattgtatca
aaatttcaaaacactgatagtgcttttaaattcaatatttcttattctactactccaatt
caattgttacaattgattttaaataaaaaatcaattactttaaacacaaaaggagagcat
cctagtgaatttatgttaaaagtttgtggccaagaagaatatttaataggaggttatcct
ttagtgagatttttgtacattcaagagtgtttatcacgagaagtcacacctacagttgtt
gtgatcataatgataaaattaaattttttagtggatcaagataatgtttatgaaaattta
gatgatttagatttaagcgcaagtaggcaaacattctctacattaacattaagaaaaaat
aaaggaaagtatttatcatcgtggactattgatgatcgattttcattaaagatttgtgca
ataagtagactgaatactgatgtaaatagaactgtaggaattcaagtgggtatttttcac
gggggtaaacccttatgtgaatctcaaaaaacttcagagaaagcagttttaaaagatgga
aaagtcgactttgaagaagaacttacatttgatattcagatctcaaatataccaaggatg
gcaagactgtgttttgctgtttatgaaatttctaaaagtgccaaaggtgttaaagctaaa
aaagttaaagattcaaaacaggatttatacatgaatcccctgacttgggtaaatacaacc
gtttacgactttaaaaatcaattaaaaacaggtgatataaccctttacatgtggacttat
gcggaagactctcagcatgaagaaatgctacaatcattgggaactgttgtttctaatacg
aatgtcgatcacgcaacggctttaacattatcgttcaaaagttactcgaccgagcataca
attatttatccgagcgttgaaaaaatgattgaacacgcggaaaaatatttcgatccatgt
tcggtagctaatttttcaccccaagatgtgaaaacgtatttggaaaacgttaggcagttg
gccgaaagcgatcctttacgtgacatgcacgaacaagacttaaaagaattgtgggctttg
cgttacgaggctcaaaaatatgttcccactttattagccaaattgttagataccgtcgaa
tggaacaatcggaacgaggttgccgaagctatatcgctattacaaaaatggccgaggttg
ccggttgaaaaagctttagaattattagattacgcttatgcagatcaacaagtgagatct
tttgcagtgaaatgtttacaatccgtttcggacgaagaactatccctatatcttttacaa
ttagttcaggctttaaagcacgaatcgtatctttcttgtgatcttgtagaatttctattg
agaagagcacttaacaataggaaaattggtcattttttgttttggcatctcaaatcggaa
atgacagtgccttgtgtatcaatacgtttcggtcttatattagaagcttattgtcgcggt
agtcaaaaacatatggatatattatcaaaacaattagattatttaaataaaatgaaagag
acttccgagttgttaagacagagaaaggatagggataaagcaaggcaatggttacacgaa
agacttggcgagtctcattgtttggaagctctgtcagatgttgtcaatcctttaaatccg
agatttaaaatgaaaaaaatcaaagtggaaaaatgcagggtcatggatagtaaaatgcgt
ccactatatttggttatggaaaatgatgatccatacggtgatgacgtttacataatattt
aaaaatggagatgatctaaggcaagacatgttagctttacaaatgattaaaataatggat
atgctgtggaaaaacgagggattggatttaagaatgaatccctacggatgcgtttccacg
gagcaccgagtgggtttaatagaagttgttctcaatgcggaaacgattgccaacattcaa
aaggaaaagggaatgttttccgctacttccgcttttagcaaaggatccttattagcttgg
ttaaaagactacaatccggaagaaaatcaacttttaaaagcgatcgaagaatttactctt
tcctgtgccggttactgcgttgccacctacgtcctgggcgtagccgatcgtcactccgac
aacataatggtaaaaaagtctggccaattgtttcacgtcgatttcggacacatattggga
cattttaaagaaaaatttggatttcgaagagagagagtaccgttcgtgttgactcacgat
ttcgtacacgtcattaacaaaggacaaaaagacaaaaaagaagcattggaatttcaaatt
tttcaaaatcattgcgaaaaagcttttttaatacttcggagacacggtagtctgatttta
tctctgtttgccatgatgatatcgacgggactcccggaattgtcgagtgaaaaagacttg
aattatttaagggaaactttagttttagatttatcggaaaacgaagcgctcttgcatttc
agatcgaaattttgcgaagctttggcgaattcatggaaaacgagtttgaattgggcttcg
cacaatctcgcgaaaaacaataagcaataa

DBGET integrated database retrieval system