KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM169940Help
Entry
Phum_PHUM169940   CDS       T01223                                 

Definition
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform, putative (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:phu00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:phu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:phu04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:phu04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:phu04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1069 aa AA seqDB search
MVHIPSPYAFDYWLREPTSSQVELSCLMPNGIFIPLPANRNAILLEIKEELWEEASKYPF
PGILRDASSYIFSCISTMGETEELRDENRRLCDIRPFCSVLKVIEKKKGDGDGDEKALNF
QISSLIGKGLHEFEALKNPEVNDFRWKMKLLGSEVARSRQNKSWLEKIAYQFPPRLASSS
AIPASCLARMREGSYFVIVSKFQNTDSAFKFNISYSTTPIQLLQLILNKKSITLNTKGEH
PSEFMLKVCGQEEYLIGGYPLVRFLYIQECLSREVTPTVVVIIMIKLNFLVDQDNVYENL
DDLDLSASRQTFSTLTLRKNKGKYLSSWTIDDRFSLKICAISRLNTDVNRTVGIQVGIFH
GGKPLCESQKTSEKAVLKDGKVDFEEELTFDIQISNIPRMARLCFAVYEISKSAKGVKAK
KVKDSKQDLYMNPLTWVNTTVYDFKNQLKTGDITLYMWTYAEDSQHEEMLQSLGTVVSNT
NVDHATALTLSFKSYSTEHTIIYPSVEKMIEHAEKYFDPCSVANFSPQDVKTYLENVRQL
AESDPLRDMHEQDLKELWALRYEAQKYVPTLLAKLLDTVEWNNRNEVAEAISLLQKWPRL
PVEKALELLDYAYADQQVRSFAVKCLQSVSDEELSLYLLQLVQALKHESYLSCDLVEFLL
RRALNNRKIGHFLFWHLKSEMTVPCVSIRFGLILEAYCRGSQKHMDILSKQLDYLNKMKE
TSELLRQRKDRDKARQWLHERLGESHCLEALSDVVNPLNPRFKMKKIKVEKCRVMDSKMR
PLYLVMENDDPYGDDVYIIFKNGDDLRQDMLALQMIKIMDMLWKNEGLDLRMNPYGCVST
EHRVGLIEVVLNAETIANIQKEKGMFSATSAFSKGSLLAWLKDYNPEENQLLKAIEEFTL
SCAGYCVATYVLGVADRHSDNIMVKKSGQLFHVDFGHILGHFKEKFGFRRERVPFVLTHD
FVHVINKGQKDKKEALEFQIFQNHCEKAFLILRRHGSLILSLFAMMISTGLPELSSEKDL
NYLRETLVLDLSENEALLHFRSKFCEALANSWKTSLNWASHNLAKNNKQ
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacataccatcaccatatgcatttgattactggttgagagaaccgaccagtagt
caagttgaacttagttgccttatgccaaatggaattttcattcctcttccagctaatcga
aatgcaatattgttggaaatcaaagaggaattatgggaagaagcaagcaagtatcctttt
ccaggaattttgagagatgcttcctcttatattttctcatgtattagtacaatgggagaa
acggaagaattacgtgatgaaaatagacgtctctgtgatattaggccattttgttctgtt
ctgaaagtcatagagaagaaaaaaggagatggtgatggagatgaaaaggctttaaatttt
caaattagttctttaattggaaaaggtcttcatgagtttgaagcattaaaaaatccagag
gtgaatgattttcgatggaaaatgaaacttctcggttctgaagttgctagaagtaggcaa
aacaaatcttggttggaaaaaatagcttatcaatttcccccaagactggcatcttcttca
gcaattcccgctagttgtttagcaagaatgagagaaggaagttattttgttattgtatca
aaatttcaaaacactgatagtgcttttaaattcaatatttcttattctactactccaatt
caattgttacaattgattttaaataaaaaatcaattactttaaacacaaaaggagagcat
cctagtgaatttatgttaaaagtttgtggccaagaagaatatttaataggaggttatcct
ttagtgagatttttgtacattcaagagtgtttatcacgagaagtcacacctacagttgtt
gtgatcataatgataaaattaaattttttagtggatcaagataatgtttatgaaaattta
gatgatttagatttaagcgcaagtaggcaaacattctctacattaacattaagaaaaaat
aaaggaaagtatttatcatcgtggactattgatgatcgattttcattaaagatttgtgca
ataagtagactgaatactgatgtaaatagaactgtaggaattcaagtgggtatttttcac
gggggtaaacccttatgtgaatctcaaaaaacttcagagaaagcagttttaaaagatgga
aaagtcgactttgaagaagaacttacatttgatattcagatctcaaatataccaaggatg
gcaagactgtgttttgctgtttatgaaatttctaaaagtgccaaaggtgttaaagctaaa
aaagttaaagattcaaaacaggatttatacatgaatcccctgacttgggtaaatacaacc
gtttacgactttaaaaatcaattaaaaacaggtgatataaccctttacatgtggacttat
gcggaagactctcagcatgaagaaatgctacaatcattgggaactgttgtttctaatacg
aatgtcgatcacgcaacggctttaacattatcgttcaaaagttactcgaccgagcataca
attatttatccgagcgttgaaaaaatgattgaacacgcggaaaaatatttcgatccatgt
tcggtagctaatttttcaccccaagatgtgaaaacgtatttggaaaacgttaggcagttg
gccgaaagcgatcctttacgtgacatgcacgaacaagacttaaaagaattgtgggctttg
cgttacgaggctcaaaaatatgttcccactttattagccaaattgttagataccgtcgaa
tggaacaatcggaacgaggttgccgaagctatatcgctattacaaaaatggccgaggttg
ccggttgaaaaagctttagaattattagattacgcttatgcagatcaacaagtgagatct
tttgcagtgaaatgtttacaatccgtttcggacgaagaactatccctatatcttttacaa
ttagttcaggctttaaagcacgaatcgtatctttcttgtgatcttgtagaatttctattg
agaagagcacttaacaataggaaaattggtcattttttgttttggcatctcaaatcggaa
atgacagtgccttgtgtatcaatacgtttcggtcttatattagaagcttattgtcgcggt
agtcaaaaacatatggatatattatcaaaacaattagattatttaaataaaatgaaagag
acttccgagttgttaagacagagaaaggatagggataaagcaaggcaatggttacacgaa
agacttggcgagtctcattgtttggaagctctgtcagatgttgtcaatcctttaaatccg
agatttaaaatgaaaaaaatcaaagtggaaaaatgcagggtcatggatagtaaaatgcgt
ccactatatttggttatggaaaatgatgatccatacggtgatgacgtttacataatattt
aaaaatggagatgatctaaggcaagacatgttagctttacaaatgattaaaataatggat
atgctgtggaaaaacgagggattggatttaagaatgaatccctacggatgcgtttccacg
gagcaccgagtgggtttaatagaagttgttctcaatgcggaaacgattgccaacattcaa
aaggaaaagggaatgttttccgctacttccgcttttagcaaaggatccttattagcttgg
ttaaaagactacaatccggaagaaaatcaacttttaaaagcgatcgaagaatttactctt
tcctgtgccggttactgcgttgccacctacgtcctgggcgtagccgatcgtcactccgac
aacataatggtaaaaaagtctggccaattgtttcacgtcgatttcggacacatattggga
cattttaaagaaaaatttggatttcgaagagagagagtaccgttcgtgttgactcacgat
ttcgtacacgtcattaacaaaggacaaaaagacaaaaaagaagcattggaatttcaaatt
tttcaaaatcattgcgaaaaagcttttttaatacttcggagacacggtagtctgatttta
tctctgtttgccatgatgatatcgacgggactcccggaattgtcgagtgaaaaagacttg
aattatttaagggaaactttagttttagatttatcggaaaacgaagcgctcttgcatttc
agatcgaaattttgcgaagctttggcgaattcatggaaaacgagtttgaattgggcttcg
cacaatctcgcgaaaaacaataagcaataa

DBGET integrated database retrieval system