KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM177490Help
Entry
Phum_PHUM177490   CDS       T01223                                 

Definition
UDP-glucuronosyltransferase 1-1 precursor, putative (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phum_PHUM177490
   00053 Ascorbate and aldarate metabolism
    Phum_PHUM177490
   00500 Starch and sucrose metabolism
    Phum_PHUM177490
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Phum_PHUM177490
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM177490
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Phum_PHUM177490
   00982 Drug metabolism - cytochrome P450
    Phum_PHUM177490
   00983 Drug metabolism - other enzymes
    Phum_PHUM177490
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Phum_PHUM177490
Glycosyltransferases [BR:phu01003]
 Others
  Hydrophobic molecule
   Phum_PHUM177490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 489 aa AA seqDB search
MNNFFYTFIIFLLCTFTLHVNYANGKNILVAFGNSGKSHFFMYEQYVEKLAERGHKITLL
TGFNTTNIKMNENVKVIKFEDEIFNFVVDLTKYESTPKILMKYNEISYINEAGQRTCRNG
LSNSNVKKFIESKKHFDVVVVEYFNTDCFSVLSHIFKAPLVGIFSSAPLPWHNDRMGNPD
NPSYVAHTLSEFSSEMNFYARLKNSLSLFFSKTYYNMYSNGPTDKIIKRNLGKGIPKVKD
IVSNTSLFLVNSHFSLFQSRPLVPSMVEVGGIHLRPPKNLPPDLQSYFDKSKDATNISTL
STKRKNAILKGFNNVTENVLMKWDADDMPEKPENVLLKKWVPQNDVLAHPKVKVFVTHGG
LMGILEAVSNGVPMIVIPLFGDQFYNAAAVAEKGCGIVLDYFSLSGDRFLRALKTVLEDK
KYSDNTKILAAKFKERPLSPMNTAIYWTEYVLKFKGAPHLRPSSKKLYWFSESLLDVHIF
ITVVLTYFN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttttttacacgtttattatatttttactatgcacgtttacattacacgta
aactatgcaaatggtaaaaatatattggtagcttttggaaattcggggaaatcccatttt
tttatgtacgagcaatatgttgaaaaattagccgaacgaggacataaaataacgcttttg
acagggttcaatacgacaaatataaaaatgaacgaaaatgttaaagtgataaaattcgaa
gatgaaatttttaattttgtcgtggatttgacaaaatatgaatcgactccgaaaatatta
atgaaatacaacgagatttcgtatataaatgaagcaggacaaagaacgtgtagaaatggt
ttgtcaaattctaatgttaaaaaatttatcgaatcgaaaaaacattttgatgttgtcgtt
gtggaatatttcaacaccgattgtttttccgttttatctcacatatttaaagctccactc
gttggtattttttcatcagctcctttaccttggcataacgatagaatgggtaacccggat
aatccatcgtacgtggcacatacattaagcgaattttcatcagaaatgaatttttacgca
cgtcttaaaaatagtctatcgttatttttttcaaaaacttattataatatgtattcaaac
ggtccaacggataaaataataaaaagaaatttgggtaaaggcattccaaaagtaaaagat
attgtatcgaatacgagtcttttcctggtaaacagtcatttttcattatttcaatctcga
cccttggtaccatcaatggtcgaagtcggtggtattcatcttcggcctccaaaaaatctt
ccacccgatttacaaagttattttgataaatcaaaagatgctactaatatttcgacgcta
tcgactaaaagaaaaaatgccattttaaaaggttttaataacgtgacggaaaacgttttg
atgaaatgggatgccgatgatatgccggaaaaaccggaaaatgttttattaaaaaaatgg
gttccacaaaacgacgtattggctcacccaaaagtaaaagttttcgtcacacatggaggt
ttgatgggaattttagaagcagtgtcaaatggtgttccaatgattgtcattcctcttttt
ggtgatcaattttataatgctgctgctgtagccgaaaaaggttgtggaatcgtattagat
tacttctctttatctggagatagatttttaagagccctaaaaactgtacttgaagataaa
aagtattccgataatacgaaaattcttgcggctaaatttaaagaaagacctctatcacca
atgaacactgccatttattggactgaatatgtattaaaatttaaaggagccccacatctt
aggccatccagtaaaaaactttattggtttagcgaatcattattagacgtacacatattc
ataacggtcgttttaacctactttaattaa

DBGET integrated database retrieval system