KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM178550Help
Entry
Phum_PHUM178550   CDS       T01223                                 

Definition
NADH-cytochrome b5 reductase, putative (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM178550
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Phum_PHUM178550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 303 aa AA seqDB search
METIPVLETGVLLLAGILAVYYLYKKTLFGKRKHSITLKDPTRKYKLKLIDVVEISHDTK
KFRFSLPSENEVLGLPIGQHITLSAVINGELVVRSYTPISSDDDIGYVDLIVKIYRKNTH
PRFPQGGKMSQYLESLSLLDTIDVRGPSGRLQYLGNGEFSIKNLRKSPPTIVKVKYVNMI
AGGTGITPMLQIIRHICKDSNDTTKVALLFANQTESDILMRKELDETAENFPNKFKLWYT
VDTAGDDWTYSTGFINADMISNHLYSEVNDTIVLMCGPPPMIKFACEPSLDYLGVDKELR
FVF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagacaattccagttttagaaactggagtgcttttacttgctggcattttagcagta
tattatttgtataaaaaaactctttttggtaagagaaaacattcgattacacttaaagat
ccgactagaaaatataagcttaaattaattgatgtcgtagaaatcagtcatgatacgaaa
aaatttagattttctcttcctagtgagaatgaggttttgggtttaccaattggacagcac
ataactctgtcagctgtaataaatggtgaacttgttgtaagaagttacaccccaatttct
agcgatgatgatataggttatgttgatttaattgtaaaaatttacagaaaaaacacacat
cctagatttcctcaaggtggtaaaatgagtcaatatttagaaagtttgtctctcttggac
acaattgatgtaagaggaccatctggtagattacaatatttaggaaatggagaattttct
attaaaaacctcagaaaaagtccacctacaattgttaaagtgaaatatgtgaacatgatt
gccggtggtactggtatcacacccatgttacaaataataagacatatttgtaaagattca
aatgatactactaaagtggctcttttattcgctaatcaaaccgaaagtgatattttgatg
aggaaagaattagacgaaacagctgaaaattttcccaataaatttaaattatggtacaca
gtagacacagcaggagatgattggacttacagtacgggattcatcaatgccgatatgatt
tctaatcatttatattcagaagtgaatgatacaattgtattaatgtgtggtcctccaccc
atgattaaatttgcatgcgaacctagtttagattatttgggtgttgataaagaattaaga
tttgttttttaa

DBGET integrated database retrieval system