KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM180970Help
Entry
Phum_PHUM180970   CDS       T01223                                 

Definition
Guanylate kinase, putative (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM180970
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Phum_PHUM180970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 212 aa AA seqDB search
MVFLNAIIIRKMVQCSIEALVLCGPSGSGKSTLLKKLLDDFPDKFQFSISHTTRSPRPGE
INGVHYYFTTKEDMSDAIENGDFIETAVFSGNIYGTSKKSVEDCVKKGKICVLDIDVQGV
KQIKETDLNALYVFIKPPSLDSLADRLRNRGTETDETLEKRLNAAKSEIGYGETPNNFHL
VIINDSIDIAYAKLKNFIMEQLFKQRKESGDE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggtttttttaaatgcaataataattcgtaaaatggttcaatgttctatagaagcgttg
gttttatgcggtccctcgggatctggtaaatcgacattactcaaaaaattattggatgat
tttcctgataaatttcaattttccatatctcatacaaccagatctccgagaccgggtgaa
ataaatggagtgcactattatttcacaacaaaggaagatatgtctgatgcaattgaaaat
ggtgattttattgaaactgcagttttttcaggaaatatctacggtaccagtaaaaaatct
gtcgaagattgtgttaaaaaaggaaaaatttgcgttttggacattgatgttcaaggagta
aagcaaattaaagaaactgatttgaatgctctatatgtttttatcaaaccaccatcattg
gactcgctcgctgatcgtttaagaaatagaggaacagaaacggatgaaacgttggaaaaa
agattgaatgctgctaaatcagaaatcggttatggagaaacacccaacaattttcatttg
gttatcattaatgactcgattgatattgcatatgcaaaactcaaaaattttattatggaa
caattatttaaacaaagaaaagagtcaggtgatgaataa

DBGET integrated database retrieval system