KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM186770Help
Entry
Phum_PHUM186770   CDS       T01223                                 

Definition
Calsequestrin-1 precursor, putative (EC:2.4.1.119)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM186770
Enzymes [BR:phu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Phum_PHUM186770
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Phum_PHUM186770
  Exosomal proteins of colorectal cancer cells
   Phum_PHUM186770
  Exosomal proteins of bladder cancer cells
   Phum_PHUM186770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MLFVKICLVLGASISFVSSSEIETDEGVLVLNKNNFQSAISDVEFILVEFYAPWCGHCKA
LAPEYAKAAKLLEEEGSKIKLAKVDATEETELAEQHNVKGYPTLKFFKKGHVVEYSGKVA
DQIVSWLKKKTGPPAKNLESVDDAKAFIDENNVVVVGFFKDQSSDNAKAFLQTAEVMDNV
VFGITSDSAVFTEYSVDGDKIVLFKKVLFVSINTDDDDHLRILEFFGMKKTDTPSMRLIK
LEEEMAKYKPVDDKVEPDNVRKFVEDFLSGNLKQHLLCQDLPEDWNKTPVHTLVASNFDE
VAFDSSKDVLVEFYAPWCGHCKQLAPIYDQLGEHFKDDDKVVIAKMDATANELEHTKISS
FPTLKLYKSGDNKVVDYSGERTLEALIKFIELGGEDLSGPEGNSLVINLNGKLRNHFYLT
VIVIIE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttatttgtgaaaatttgcttagttcttggagcgtctatttcttttgttagctcttca
gaaatagaaactgatgaaggagttttagttttaaataaaaataattttcagtcagcgatt
tctgacgttgaatttatcttagttgaattctatgctccgtggtgtgggcattgcaaagca
ttagctcctgaatatgctaaagctgctaagttattagaagaagaaggatctaaaattaaa
ttagccaaagtagatgctacagaggaaacagagttagcagaacaacataatgtcaaagga
tacccaaccttgaaatttttcaaaaaaggacatgtagttgaatattcaggcaaagttgct
gatcaaattgtcagctggttaaagaaaaagactggtccaccagccaaaaacttggaatct
gtagatgatgccaaggcattcatcgatgaaaataatgttgtggttgtgggattctttaag
gatcaatcatcagataatgctaaagcattccttcaaactgctgaagtaatggataatgtt
gtttttggtattacatcagacagtgcagtgttcacagaatattccgtagatggcgataaa
attgttctcttcaaaaaagttttgtttgtttcaattaacacagacgatgatgatcactta
agaattttagaatttttcggtatgaaaaaaacagatactccttcgatgaggttgatcaaa
cttgaagaagaaatggccaaatacaaaccagtcgatgataaggttgaaccagataacgtt
agaaagtttgttgaagattttcttagcggtaacctcaagcaacatcttttgtgccaagac
cttcccgaagactggaataaaactccggtacatacattggtggcatctaatttcgatgaa
gttgcatttgattcatcaaaagacgtcttggtggaattttacgctccttggtgtggtcac
tgtaaacaattggctcccatttatgatcagttgggagaacattttaaagacgatgataaa
gttgtcattgctaaaatggatgcgacggccaatgaacttgagcacacgaaaatttcaagt
tttccaactttgaaattgtacaaatcgggagacaacaaagttgtcgattattcgggtgaa
agaacactcgaagctctcattaaatttatcgaattgggcggcgaagatttgtcaggaccc
gaaggaaattcactcgtgataaatttaaatggaaaattgcgcaatcatttttatttaact
gtaatcgtcatcatcgagtga

DBGET integrated database retrieval system