KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM188140Help
Entry
Phum_PHUM188140   CDS       T01223                                 

Definition
protein disulfide-isomerase TXNDC10 precursor, putative (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MFYAPWCAHCKRLEPIWNHVAQSLHSTNIRVGRLDCTRFTNTALEFGVTGYPTMIFIKQD
LEFTFKGDRTREEMVNFALRLSGPPVQKITKSESISHLKAVKNLFFVYVGEIEGPVWETY
YNVAERFQPYGFFYCVSRHLTKPHFSVKTEPAILVYKENTIYFYEGEFVYHENENFNSSL
HTWVNEERFLTFPKITKGNLDQFFQINKYLVLVVLEENKLEEIPADMLEFRDMVESVIRS
HRMRYHKHFQFGWVGSPDLANSIAMDILPLPHLIVVNSTTQHHHFPQDEPSRLTTQALIM
FLDQVHNQSAPVFGGNTLCVRLYRLYFEAKTSLMDMWQGNPVLTSVLFGLPLGFLSLICY
SICCSDIMDADDEEEEEFFHEKKE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgctccgtggtgtgctcattgcaaaagacttgagcctatttggaatcacgta
gctcaatctttgcatagtacaaatataagagttggaagattagattgtacaaggtttacc
aatactgcattagaatttggagttactggctatcccaccatgattttcataaaacaagat
ttagaatttacatttaaaggtgatagaacaagagaagaaatggtaaattttgctttaaga
ctttcaggacctccagttcaaaaaataacaaaatctgaaagcattagtcatttaaaagct
gtcaaaaatttattttttgtttatgtaggagaaatagaaggacctgtttgggaaacttat
tacaatgtggctgaaagatttcaaccctatggttttttctattgtgtatctcgacatttg
acaaaacctcatttcagcgtaaaaacagaacctgctatacttgtatataaagaaaatact
atttatttttatgaaggtgagtttgtttatcatgaaaatgaaaatttcaattcttctctt
cacacttgggttaacgaagaaagatttttaacttttccaaaaataacaaaaggaaattta
gatcaattttttcaaataaataaatatcttgtgttggttgttttggaggaaaacaaactt
gaagaaattccagctgatatgcttgagtttcgtgatatggttgaatccgttataagatcg
catcgtatgagatatcataaacattttcaattcggttgggtcggaagtcctgatcttgct
aattccatagcaatggacattttacctttaccacatttaattgttgttaattcaacgact
caacatcatcattttccacaggatgaaccttcgcgtttaacgactcaagcattgatcatg
tttttggatcaagtacacaatcaatcagctccagttttcggaggtaacactttgtgcgta
cgtttgtacaggttgtatttcgaagcgaaaacttctcttatggacatgtggcaaggaaat
cctgtacttacttctgttttattcggacttcctcttggttttcttagtttgatttgttat
tcgatatgttgttcggatatcatggatgcagacgatgaagaagaagaggaattttttcac
gagaagaaggaataa

DBGET integrated database retrieval system