KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM189890Help
Entry
Phum_PHUM189890   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Phum_PHUM189890
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Phum_PHUM189890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 542 aa AA seqDB search
MLPTQGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATTKAATDCKLWAIERQCFQTI
MMRTGLIRQAEYTNFLKSVPIFKNLPEDTLIKISDVLEEAYYNQGDYIIRQGARGDTFFI
ISKGEVKVTIKQPNTSEEKYIRTLGKGDFFGEKALQGDDLRTANIIANDPEGVTCLVIDR
ESFNQLISGLDEIRTKYADEGIERRNVNETRWVRLINVVNEEFRDLKLSDLRILATLGVG
GFGRVELVQIAGDCTRSFALKQMKKSQIVETRQQQHIMSEKDIMSEANCDFIVKLYKTFK
DRKYLYMLMESCLGGELWTILRDKGHFDDSTTRFYTACVVSAFDYLHSRNIIYRDLKPEN
LLLDVQGYVKLVDFGFAKKLQHGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMF
ELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATVLIKKLCRDNPVERLGYQKGG
ISEIQKHKWFDGFNWEGLTTRTLTPPILPKVQDALDHSNFDEYPPDADGPPPDDITGWDQ
NF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaacacagggacgcgtggaagtatcgcgagaaaacaaatacctgagcacatta
gcaccgggaaaagttttcggagaattagccatattatacaattgcaaaagaacagccacg
acgaaagcagcaaccgattgcaagctatgggcaatagaacgacaatgttttcaaacgatc
atgatgagaacgggtctcatccgtcaagcagaatacacgaatttcttaaaaagcgtacca
atattcaaaaacttgccagaagacactcttataaaaatatcagacgttttggaagaagct
tattacaaccagggtgactacataatacgtcagggtgcgaggggtgacacgtttttcatt
ataagcaaaggtgaagttaaagtcacgataaaacaacccaacacgtccgaagaaaaatac
ataagaactttgggaaaaggagatttcttcggtgaaaaagctttgcaaggtgacgatttg
agaactgccaacataatagcaaacgatcccgaaggtgtcacttgtttggtaatcgataga
gaatccttcaatcagttaatatccggtttagatgaaataagaacgaaatatgccgacgaa
ggaatagaaagacgaaatgtcaatgaaacgaggtgggtgaggttaattaatgtggtcaac
gaagaattccgcgatcttaaactatccgatttgagaattttggcaacactgggagtcggt
ggttttggaagagtagaattagtacaaatagctggagattgtacgagatcgtttgcattg
aaacaaatgaaaaagagtcagatcgttgaaacgagacaacagcaacacataatgtcggaa
aaggatataatgagcgaagcaaattgcgattttattgttaaattatataaaacattcaaa
gatagaaaatatttatacatgctcatggaatcgtgtctcggcggtgaattgtggaccata
ctcagagataaaggacattttgacgattccacaacgagattttacacggcatgcgtcgtt
tccgcattcgattaccttcacagcagaaacatcatttatagagatttgaaaccggaaaat
cttttgctagacgtacagggatatgttaaattggttgattttggttttgctaaaaaactc
cagcacggtagaaagacttggacattctgcggtacaccagaatatgttgctccagaagtc
atattgaacaggggccacgatataagcgccgattattggtcgttgggagttttaatgttt
gaattattaacgggtactccaccattcaccggatccgatccaatgaaaacttacaacatt
atattaaagggaatagatgcaattgaatttccgaggaacataacgagaaacgcgacggtt
cttataaaaaaattatgccgggataatccagttgaaagactcgggtatcaaaaaggtgga
ataagcgaaatacaaaaacacaagtggttcgacggtttcaattgggaaggtttaacgacg
agaacgttaactcctccgattttgcccaaagttcaagatgctctcgatcattctaatttt
gacgaatatcctccggatgcggatggaccaccgccggatgacatcacgggatgggatcaa
aatttttaa

DBGET integrated database retrieval system