KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM196800Help
Entry
Phum_PHUM196800   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.12.2)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM196800
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Phum_PHUM196800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 372 aa AA seqDB search
MNLNHFNTPPSTLMKDGTIPTNHRQNLPKIVPFNQEILIEMSRERLNLTQTMQSSGRLEV
SPNSVYDFTSDDLQDLGEIGRGAFGTVNKMIHRKSNTVMAVKRIRSTIDEREQKILLMDL
DVVMKSNDCPFIVKFYGALFKEGDCWICMQLMDTSLDKFYKFIYEKLKQRIPENIIGKIT
VATVKALNYLKEELQIIHRDVKPSNILLDKQGNIKLCDFGISGQLVDSIARTRDAGCRPY
MAPERIDPQTAKGYDVRSDVWSLGITLMEVSTGHFPYPKWNTVFEQLNQVVKGDPPRLSP
NEDGITFTMDFVRFVNTCLIKDEDQRPKYNALLQHPFIKKSDEDKVDVALYVSEILNNMT
NNGATQFTMNEP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaatcacttcaatacacctccttctactttaatgaaagatggaaccattcca
actaaccataggcaaaatttacccaaaatagttccatttaatcaagaaattttaatagaa
atgtctcgggaaagattaaatttaactcaaaccatgcaatcatctggtagattagaagta
tcaccaaattcagtttatgattttacttctgacgatcttcaagatttaggtgaaatagga
cgaggagcttttggtactgttaacaaaatgatacacagaaaatcaaatacagtgatggct
gtaaagagaattagatctacaattgatgaaagagagcaaaaaattttgcttatggattta
gatgttgttatgaaatcaaatgattgcccttttattgttaaattttatggtgctttattc
aaagagggggattgttggatatgtatgcaacttatggatacttcattagataaattttat
aaatttatttatgaaaaactaaagcaaagaattccggaaaatattataggaaaaataacc
gttgctactgttaaagctcttaattacttaaaagaagaacttcaaataattcacagagat
gtgaaacctagcaatatattattagataaacaaggaaatatcaaattatgtgattttggt
atatctggacaactggttgattcaattgcaagaacaagagacgctggctgcagaccttac
atggcacctgaaaggatagatccacaaactgctaaaggttatgatgtgagatctgatgtt
tggtcgttaggaattacattaatggaagtgtcaacaggtcattttccatatcctaaatgg
aatacagtgtttgaacaattaaatcaagttgttaaaggtgatccacccaggttatctccc
aatgaagatggaatcacttttacaatggactttgtacgatttgttaatacatgtttaatt
aaagatgaggatcagagacccaaatataatgctcttcttcaacatccttttataaaaaaa
tcagatgaagataaagttgatgtggctctttatgttagtgaaatattaaataatatgacc
aataatggtgctacacaatttacaatgaatgaaccttga

DBGET integrated database retrieval system