KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM204070Help
Entry
Phum_PHUM204070   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 562 aa AA seqDB search
MCEKKEENEKKDKANDIDDHISKRYEMKKRLGKGAYGIVWKAVDKKSREVVAVKKIFDAF
RNQTDAQRTFREIMFLQAFKDHPNIIRLRGLHKASNNRDIYLVFDYMDSDLHHVIKKGNI
LKDIHRRYIMYQLLRATRYLHSGDVIHRDQKPSNILINAECRIKLADFGLARSLANYYTE
EETEGPPLLTDYVATRWYRAPEILVASKRYTKGVDMWSLGCILGEMLLGKPLFPGSSTVN
QIERIMAALPKPTPQEISNMCTGYGKSLLEGVIGQKTNLKDMIKSSSQEAIDLVTKLLIF
DPGKRLTASQALTHPYVSKFCNGSEICLDHSIIPPLNDDVQLSVSEYRNKLYELIANGKN
TISKKQGSTSSSSKNKTLDVDRSRKSIENVQKKLTKYIENRGKRDEMTDLRKYRSSSYKN
HSVEELREKSGFTNPVIATKSEPSQKTVVKKIGSSPQHRHNVPPVQNRNDCWSEWSSKPF
IGIQNCGDECNLTKTSGHGGHFINASPKPVKGTTTISYHQEKHRQNNYKFGNISSLPKVA
VQKNDFVNHYPDNTSSSSSLTR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaaaaaaaggaggaaaatgaaaagaaagacaaagccaacgatattgatgatcac
atatcaaaaagatatgaaatgaaaaaacgattgggaaagggagcctatggaatcgtttgg
aaagccgttgataaaaaaagtagagaagttgtagccgttaaaaaaatattcgatgcattt
agaaatcaaacagatgcacaaagaacttttcgtgaaattatgtttcttcaagcatttaaa
gatcatccaaatataattcgtttaagaggacttcataaagcatctaataacagagatatt
tatttagtttttgattacatggacagcgatttacatcatgttattaaaaaaggaaacata
ttgaaagacatacataggagatacataatgtatcaattattacgagcaacgagatatcta
cattctggggatgtaatacacagagatcaaaaaccatcgaatattctcataaacgcagaa
tgtagaataaaactagcagatttcggattggcgagatctcttgctaattattatacagaa
gaagaaacggaaggaccgccattgctcacggattatgttgccacgagatggtacagagca
ccggaaatattagttgcatcgaaaaggtatacaaaaggagtagatatgtggtcgttgggt
tgcatattgggtgaaatgcttttgggaaaacctttatttccgggatcatcgacggtaaat
caaatcgaaagaataatggctgcacttcccaaaccgactcctcaagaaatcagcaacatg
tgtaccggatatggtaaaagtttattagaaggtgtaattggacaaaaaacaaatctcaaa
gacatgataaaatcatcttcgcaagaagccatcgatttagttacaaaattattaatattt
gatcccggaaaacgattaacagcatctcaagcattgactcatccatacgtatcaaaattt
tgcaacggtagcgaaatatgtttagatcacagtataattccaccgttaaatgacgatgtt
caactttcggtatccgaatatcgtaacaaactttatgagcttatagccaacggtaagaac
acgataagtaaaaaacaaggatcgacatcgagttcgagtaaaaacaaaacattagacgtg
gatcgcagtaggaaatcaatagaaaacgtacaaaaaaaactaactaaatacattgaaaac
agaggaaaaagagacgaaatgacagatctaagaaaatacaggtcgtcgtcatataaaaat
cattcagtcgaagaattaagagaaaaatctggttttacaaatccggtgatagcaacaaaa
tcagagccaagtcaaaaaacagtagttaagaaaattggttcaagtcctcaacataggcat
aatgttcctccagttcaaaatcgtaacgattgttggtctgaatggtcatcgaaaccattt
attggaatacaaaattgtggtgacgaatgtaatttaacaaaaacttccggtcacggtggt
cattttataaatgcaagtccaaaaccagtaaaaggaacaacaaccatttcttatcaccaa
gaaaaacatcgtcagaataattacaaatttggaaatatatcaagtctgccaaaagtcgcc
gtacagaaaaacgattttgttaatcattatccggataatacatcatcatcatcatctctt
acgaggtga

DBGET integrated database retrieval system