KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM211140Help
Entry
Phum_PHUM211140   CDS       T01223                                 

Definition
Dopamine beta-hydroxylase precursor, putative (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:phu00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 574 aa AA seqDB search
MSINIILLIFYFILNNTKGSEVYKIALKGDNKTNLYWTINYPKEILNFEIHVSLPKNFWF
AIGFSPYGELKLADFCILWTDWKNKIHFQDAWTSEEGRISVDASQDCTNFQFFKTKEGIK
FGFRRKFITCDADDYEIEDGTTHIVWAQGKGPLFRLEGVNIYSAMISGFERAQLLKNINS
YENHPSDTWTLEILTNKVKVPETETTYWCHVHKLPEKLIKKHHIIQYESVIQKGNEHLVH
HIEVFHCETSVNETIPSFAGSCFAENRPEKTKVCKKVIAAWAMGAQAFSYPQEAGLPIGG
PNYNRFVMLEVHYNNPELKNDWVDSSGIRFYLTPSLRKYDGGVIELGLEYIDKMAIPPGQ
KRFQLSGFCITECTAVGLPETGIIVFGSQLHTHLLGTQVYTKHVRNGQELPELNRDNHYS
THFQEIRKLKRFVKVLPGDALITTCTYKSTEKNNVTLGGFSITDEMCVNYIHYYPKTNLE
VCKSSISYENLFNYFNYLRSYENQDTDSEKAISYNYNAIEWTPLRVEVLNDLYSNAGISM
QCNQSSGERFPGDWENLPVTKIYKPLPMPKSKCY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaatattattttattaattttttattttattttaaataataccaagggatca
gaggtgtataaaattgcattgaaaggagataataaaacaaatttatattggaccattaat
tatccaaaagaaattcttaattttgaaattcacgttagtctaccgaaaaatttttggttt
gcaattggattttcaccttacggagaactcaaacttgctgatttttgtattttatggact
gactggaagaataaaatacattttcaagatgcttggacgtcggaagaaggtagaatttcc
gttgatgcatcacaggattgtactaattttcaatttttcaaaacaaaagaaggaatcaaa
tttggatttcgtagaaaattcatcacatgtgacgcagatgattacgaaatcgaggatggt
accactcatattgtttgggctcaaggtaaaggaccattgtttaggctggagggtgtcaac
atttattcagcaatgattagcggttttgaaagagctcaactgttaaagaatattaatagt
tatgaaaatcatccatcggatacttggacgttggaaattcttacaaataaagtcaaagtt
cctgaaacggaaacaacatattggtgtcatgtacacaaactccctgagaaattgataaag
aaacaccatataattcagtacgaatcggttatacagaaaggaaacgaacatttggtacat
catatagaagtattccattgtgaaacttccgttaatgaaacaataccgagttttgctggt
tcttgttttgcagaaaacagaccagaaaaaacaaaagtttgtaaaaaagtaattgcagct
tgggcaatgggagctcaagctttttcataccctcaagaggctggattaccaatcggtgga
ccaaattacaatcgttttgttatgttggaagttcattataacaatccagagctcaaaaac
gattgggtagatagttctggtatccgattttatttaaccccatcattaagaaaatatgat
ggaggagttattgaactaggtttagaatacatagacaaaatggcaataccaccaggtcaa
aaacgtttccaattatctggattttgtatcacggaatgtacggcagtgggattacccgag
acaggtatcatcgttttcggatctcaacttcatacacatctactagggactcaagtttac
actaaacatgtaagaaatggacaagaacttccagaattgaatagagacaatcattacagt
actcattttcaagaaataagaaaacttaaacgttttgttaaagttcttccaggggatgca
ctgataacgacttgcacgtacaaatcgacagaaaaaaataacgtgactttagggggattt
tcaataacggatgaaatgtgcgttaattacattcattattatccaaaaacaaatttagaa
gtttgcaagagttcaatatcatatgaaaatttatttaattattttaattatttacgaagt
tatgaaaatcaagacacggattcagaaaaggcaattagttataattataatgcaatagaa
tggacacctcttcgagttgaagttttaaatgatttatattcgaatgcagggatttccatg
caatgcaatcaatcatccggtgaaagatttcccggagattgggaaaatcttccagtaacg
aaaatttataaacctttaccaatgccaaaatcaaaatgctattaa

DBGET integrated database retrieval system