KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM211140Help
Entry
Phum_PHUM211140   CDS       T01223                                 

Definition
Dopamine beta-hydroxylase precursor, putative (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Phum_PHUM211140
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Phum_PHUM211140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 574 aa AA seqDB search
MSINIILLIFYFILNNTKGSEVYKIALKGDNKTNLYWTINYPKEILNFEIHVSLPKNFWF
AIGFSPYGELKLADFCILWTDWKNKIHFQDAWTSEEGRISVDASQDCTNFQFFKTKEGIK
FGFRRKFITCDADDYEIEDGTTHIVWAQGKGPLFRLEGVNIYSAMISGFERAQLLKNINS
YENHPSDTWTLEILTNKVKVPETETTYWCHVHKLPEKLIKKHHIIQYESVIQKGNEHLVH
HIEVFHCETSVNETIPSFAGSCFAENRPEKTKVCKKVIAAWAMGAQAFSYPQEAGLPIGG
PNYNRFVMLEVHYNNPELKNDWVDSSGIRFYLTPSLRKYDGGVIELGLEYIDKMAIPPGQ
KRFQLSGFCITECTAVGLPETGIIVFGSQLHTHLLGTQVYTKHVRNGQELPELNRDNHYS
THFQEIRKLKRFVKVLPGDALITTCTYKSTEKNNVTLGGFSITDEMCVNYIHYYPKTNLE
VCKSSISYENLFNYFNYLRSYENQDTDSEKAISYNYNAIEWTPLRVEVLNDLYSNAGISM
QCNQSSGERFPGDWENLPVTKIYKPLPMPKSKCY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaatattattttattaattttttattttattttaaataataccaagggatca
gaggtgtataaaattgcattgaaaggagataataaaacaaatttatattggaccattaat
tatccaaaagaaattcttaattttgaaattcacgttagtctaccgaaaaatttttggttt
gcaattggattttcaccttacggagaactcaaacttgctgatttttgtattttatggact
gactggaagaataaaatacattttcaagatgcttggacgtcggaagaaggtagaatttcc
gttgatgcatcacaggattgtactaattttcaatttttcaaaacaaaagaaggaatcaaa
tttggatttcgtagaaaattcatcacatgtgacgcagatgattacgaaatcgaggatggt
accactcatattgtttgggctcaaggtaaaggaccattgtttaggctggagggtgtcaac
atttattcagcaatgattagcggttttgaaagagctcaactgttaaagaatattaatagt
tatgaaaatcatccatcggatacttggacgttggaaattcttacaaataaagtcaaagtt
cctgaaacggaaacaacatattggtgtcatgtacacaaactccctgagaaattgataaag
aaacaccatataattcagtacgaatcggttatacagaaaggaaacgaacatttggtacat
catatagaagtattccattgtgaaacttccgttaatgaaacaataccgagttttgctggt
tcttgttttgcagaaaacagaccagaaaaaacaaaagtttgtaaaaaagtaattgcagct
tgggcaatgggagctcaagctttttcataccctcaagaggctggattaccaatcggtgga
ccaaattacaatcgttttgttatgttggaagttcattataacaatccagagctcaaaaac
gattgggtagatagttctggtatccgattttatttaaccccatcattaagaaaatatgat
ggaggagttattgaactaggtttagaatacatagacaaaatggcaataccaccaggtcaa
aaacgtttccaattatctggattttgtatcacggaatgtacggcagtgggattacccgag
acaggtatcatcgttttcggatctcaacttcatacacatctactagggactcaagtttac
actaaacatgtaagaaatggacaagaacttccagaattgaatagagacaatcattacagt
actcattttcaagaaataagaaaacttaaacgttttgttaaagttcttccaggggatgca
ctgataacgacttgcacgtacaaatcgacagaaaaaaataacgtgactttagggggattt
tcaataacggatgaaatgtgcgttaattacattcattattatccaaaaacaaatttagaa
gtttgcaagagttcaatatcatatgaaaatttatttaattattttaattatttacgaagt
tatgaaaatcaagacacggattcagaaaaggcaattagttataattataatgcaatagaa
tggacacctcttcgagttgaagttttaaatgatttatattcgaatgcagggatttccatg
caatgcaatcaatcatccggtgaaagatttcccggagattgggaaaatcttccagtaacg
aaaatttataaacctttaccaatgccaaaatcaaaatgctattaa

DBGET integrated database retrieval system