KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM212940Help
Entry
Phum_PHUM212940   CDS       T01223                                 

Definition
delta-aminolevulinic acid dehydratase, putative (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:phu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MLQVQANKNLLHGGYFHSVLRFLQSSNAVLSNSNLMYPIFLIDDDDAIETIPDFPKVYRY
GVNKIVTALEPLVKKGLSSVLLFGVIKTLPKDDFGTHANSDSNPVLRAINKIKTAFPNLL
IACDVCLCPYTIHGHCGILNSDGTIDNKKSVARLASVALSYGEAGAHILAPSDMMDGRIY
AIKQKLIDSGLHNKVSLLSYSVKFSSCFYGPFRKAANSSPCSGDRKAYQLPGGSSGLAKR
AAARDVEEGADMLMVKPGLPYLDVIESTKKSFPEFPLFVYQVSGEYSMLISASEAGVVDL
KDSVLEIMSSFRRAGADCIITYFTPLILDWIENDGKNSEHKAMSLSM
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaagtacaagctaacaaaaatctccttcacggagggtactttcattcagtatta
agatttttgcaatcatctaatgcagtactttccaatagtaatttgatgtatccaattttt
ttaattgatgatgatgacgcaatagaaactattccagattttcccaaagtttatagatat
ggagttaataaaatagttaccgcccttgaaccattagttaaaaaaggtctatcttctgtt
ttactctttggcgttattaaaacattaccaaaagacgattttggtacacatgcaaattca
gatagtaatcctgttttgagagctataaataaaattaaaacagcttttccaaatttactt
atcgcttgtgatgtgtgtttatgtccttacactatacatggccattgtggaatattaaat
tcagatggaaccattgataataaaaaaagtgtagcaagattagcttcggtagctttatcg
tatggtgaagcaggagctcatatattggctccttctgatatgatggatggaagaatttat
gcgattaaacaaaaacttatcgattctggattgcacaataaagtatcacttttatcatat
tcagtaaaattttcttcttgtttttatggaccatttagaaaagcagcaaattctagtcct
tgttctggagatcgtaaagcatatcagcttccaggtggaagttctggtctagctaaaaga
gctgccgcaagagatgtagaagaaggtgctgacatgctaatggtaaaacctggtcttcca
taccttgatgtaatcgaaagcacgaaaaaatcatttccagaatttcctttattcgtttat
caggtttcaggtgaatattccatgttgatttcagcatccgaagctggagttgtcgatttg
aaagatagtgttttagaaataatgtcctcctttcgtagagcaggtgcagattgtataatt
acatatttcactccgttaatattagactggatagaaaatgatgggaaaaattctgagcat
aaggctatgtctttatcaatgtga

DBGET integrated database retrieval system