KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM219790Help
Entry
Phum_PHUM219790   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:phu03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MDSVEEEFVCSVDKEDLNGYYRLHTIWKKNSFIINITSKNGAWSGECKEILTTHNGYPKI
SYMVQNGCFVWKKIIDEDSGIKLKIGSVKLLPANFEETVQKCLTVALNSNDKLKKEVGEL
KKENEKNLSENKKLFSKLDEITNVKINMETDLYKKFQLLLNTKKEKIAYLENIISRGKID
ESFNPYDVDTENEDDHYTDDDNDDIIKKTIETNKSDFSKSDIICEISENNLFKEKSKETE
DFISNKKIKEHESYVTIDNPDNETTKINNSDIEQNKILDESNSNKTSESKNFPSTKEELL
TFFYGS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggattccgttgaagaagaatttgtttgttccgttgacaaagaagatttaaatggttat
tacagacttcatacaatttggaagaaaaatagttttattataaatattacgtcaaaaaat
ggagcttggagtggtgagtgcaaagaaattttaacaacacataatggatatccaaaaata
agttacatggttcagaatggatgttttgtgtggaaaaaaattattgatgaagatagtgga
attaaattaaaaataggatctgttaaattattgcctgcaaattttgaagagactgttcaa
aaatgtctaactgtagctcttaattcaaatgacaaattaaaaaaagaagtcggagaattg
aaaaaagaaaatgaaaaaaatttatctgaaaacaaaaaattgtttagtaaattagatgag
atcacaaatgtaaaaataaatatggaaactgacttgtataaaaaatttcagttattgctt
aatacaaaaaaagaaaaaatagcttatctggaaaatattattagccgtggaaaaatagat
gaaagttttaatccttacgatgttgatactgaaaacgaggatgatcactatacagatgat
gataatgatgacattataaaaaaaacaatagaaacaaataagagtgatttttcaaaaagt
gatataatttgtgaaatatctgaaaataatttgtttaaagaaaaaagtaaagaaacagaa
gattttattagcaacaaaaaaattaaagaacatgaaagttatgtaacaattgataaccca
gacaatgaaacaacaaaaataaataattcagatattgaacaaaataaaatattagatgaa
agtaattctaataaaacatcagaaagtaaaaattttccatcgacaaaagaggaactttta
acatttttttacggttcttaa

DBGET integrated database retrieval system