KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM221310Help
Entry
Phum_PHUM221310   CDS       T01223                                 

Definition
(RefSeq) protoporphyrinogen oxidase, putative
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00860  Porphyrin and chlorophyll metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM221310
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Phum_PHUM221310
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Phum_PHUM221310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Thi4 MCRA Pyr_redox_2 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 8237775
NCBI-ProteinID: XP_002425815
VectorBase: PHUM221310
UniProt: E0VI71
AA seq 471 aa AA seqDB search
MTNVVIGGGISGLSTAYYLSKIIKDKIKIFESSHRVGGWIKSTKNNNGTIFEQGPRTLRC
GGLAADNTLDLINELGLSSEIKPVHRNSISGKNRMIYLNNQLISLPNSWLSLFKINPPFI
KPFLFAIIKDLSTSKKVVHDESIYDFVSRRFGKDYADIPLSAMICGIFAGDAKEISVKAL
MNSLFEKEQKYGSVIGGMLLSLKDNYFEKKNFNRVGINKKKSKIWSVWTLENGLETLPIY
LNNYLKNRPNIDIRLNSKCSEIKFKNGEVVLKYNDKTINAKHLYSCLPSKDLADILNDDE
HIYLKKELSSIPFVSVAVVNLEYNGDLIEKKGFGLLVPPNQNLPILGIIFDSCIFSQNNN
KTVITVMMGGKWFEHYFGKNSNDDDKFLNVALKQVNDILKINENPLDYKITIMNECIPQY
IVGHFEKIKKIRNYILEKNLPLTLIGNSYDGVGVNDSIYSAKINVDNVHNR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgttgtaattgggggtggaataagcggtttgtctaccgcttattatttatct
aagataataaaagacaaaataaaaatttttgaatcgtcacacagagttggcggttggata
aaatcaacaaaaaataataacggaacgatatttgaacaaggcccaagaactttaagatgt
ggcggattagctgctgataatactctcgatcttattaacgaattaggattatcctccgag
atcaaaccagttcatcgtaatagcataagtggtaaaaatcgaatgatatatttgaataat
caattgatatcgttacccaattcttggctttccttatttaaaataaatccaccatttatc
aaaccgtttttatttgcaataattaaagatttgtcgacttctaaaaaagttgtacacgat
gaaagtatttacgatttcgtttcccgaagatttggaaaagactatgctgatatcccgttg
agtgctatgatttgtggaatattcgcaggagatgccaaagagataagtgtcaaagcattg
atgaatagtttgtttgaaaaagaacaaaaatatggtagcgtcattggtggaatgcttctg
tctctaaaagataattattttgagaaaaaaaattttaatagagtgggaattaataaaaaa
aaatcaaaaatatggtcggtttggacattggaaaacggtttagaaacattacccatttat
ttaaataattatttaaaaaatcgaccaaacattgacattcgtttaaattcaaaatgttct
gaaatcaaatttaaaaatggtgaagttgttttaaaatataatgataaaacaattaatgca
aaacatttatattcatgtttgccgagtaaagatttagctgacattttaaatgatgatgaa
cacatttatttaaaaaaagaactttcatcgattccatttgtaagcgtggctgttgttaat
ttagaatacaatggagatttgattgagaaaaaaggtttcggtttattagtaccgccaaat
caaaacttaccaatattaggcatcattttcgattcttgtatcttttcgcagaataataat
aaaacagttataactgttatgatggggggaaaatggtttgaacattattttggaaaaaat
tcaaacgatgatgataaatttttaaatgtcgcattgaaacaagttaacgatatactaaaa
ataaatgaaaatcctctcgattataaaataacaattatgaatgaatgcattccacaatac
attgtcggtcattttgaaaaaataaaaaaaataagaaattacatactggaaaaaaattta
ccgttgacacttattggtaattcatatgatggagtcggagttaatgattcaatttattct
gctaaaatcaacgtcgataacgttcataatcgttaa

DBGET integrated database retrieval system