KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM221310Help
Entry
Phum_PHUM221310   CDS       T01223                                 

Definition
protoporphyrinogen oxidase, putative (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM221310
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Phum_PHUM221310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 471 aa AA seqDB search
MTNVVIGGGISGLSTAYYLSKIIKDKIKIFESSHRVGGWIKSTKNNNGTIFEQGPRTLRC
GGLAADNTLDLINELGLSSEIKPVHRNSISGKNRMIYLNNQLISLPNSWLSLFKINPPFI
KPFLFAIIKDLSTSKKVVHDESIYDFVSRRFGKDYADIPLSAMICGIFAGDAKEISVKAL
MNSLFEKEQKYGSVIGGMLLSLKDNYFEKKNFNRVGINKKKSKIWSVWTLENGLETLPIY
LNNYLKNRPNIDIRLNSKCSEIKFKNGEVVLKYNDKTINAKHLYSCLPSKDLADILNDDE
HIYLKKELSSIPFVSVAVVNLEYNGDLIEKKGFGLLVPPNQNLPILGIIFDSCIFSQNNN
KTVITVMMGGKWFEHYFGKNSNDDDKFLNVALKQVNDILKINENPLDYKITIMNECIPQY
IVGHFEKIKKIRNYILEKNLPLTLIGNSYDGVGVNDSIYSAKINVDNVHNR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgttgtaattgggggtggaataagcggtttgtctaccgcttattatttatct
aagataataaaagacaaaataaaaatttttgaatcgtcacacagagttggcggttggata
aaatcaacaaaaaataataacggaacgatatttgaacaaggcccaagaactttaagatgt
ggcggattagctgctgataatactctcgatcttattaacgaattaggattatcctccgag
atcaaaccagttcatcgtaatagcataagtggtaaaaatcgaatgatatatttgaataat
caattgatatcgttacccaattcttggctttccttatttaaaataaatccaccatttatc
aaaccgtttttatttgcaataattaaagatttgtcgacttctaaaaaagttgtacacgat
gaaagtatttacgatttcgtttcccgaagatttggaaaagactatgctgatatcccgttg
agtgctatgatttgtggaatattcgcaggagatgccaaagagataagtgtcaaagcattg
atgaatagtttgtttgaaaaagaacaaaaatatggtagcgtcattggtggaatgcttctg
tctctaaaagataattattttgagaaaaaaaattttaatagagtgggaattaataaaaaa
aaatcaaaaatatggtcggtttggacattggaaaacggtttagaaacattacccatttat
ttaaataattatttaaaaaatcgaccaaacattgacattcgtttaaattcaaaatgttct
gaaatcaaatttaaaaatggtgaagttgttttaaaatataatgataaaacaattaatgca
aaacatttatattcatgtttgccgagtaaagatttagctgacattttaaatgatgatgaa
cacatttatttaaaaaaagaactttcatcgattccatttgtaagcgtggctgttgttaat
ttagaatacaatggagatttgattgagaaaaaaggtttcggtttattagtaccgccaaat
caaaacttaccaatattaggcatcattttcgattcttgtatcttttcgcagaataataat
aaaacagttataactgttatgatggggggaaaatggtttgaacattattttggaaaaaat
tcaaacgatgatgataaatttttaaatgtcgcattgaaacaagttaacgatatactaaaa
ataaatgaaaatcctctcgattataaaataacaattatgaatgaatgcattccacaatac
attgtcggtcattttgaaaaaataaaaaaaataagaaattacatactggaaaaaaattta
ccgttgacacttattggtaattcatatgatggagtcggagttaatgattcaatttattct
gctaaaatcaacgtcgataacgttcataatcgttaa

DBGET integrated database retrieval system