KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM222190Help
Entry
Phum_PHUM222190   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:phu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Phum_PHUM222190
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Phum_PHUM222190
Peptidases [BR:phu01002]
 Metallo Peptidases
  Family M67
   Phum_PHUM222190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 385 aa AA seqDB search
MYRNKKPDTNSLFTEAVCEGDSFNSLESPSFSTDEAVVLEPSARIKALADSGNAFEVDHH
IPPRKYYRSGLEMVRMADVYLKEGSLENAYVLYMKFMTLFLEKIRKHPNFKSVSIVDRAQ
NDAKLKEVLTKAEKLKTKLLDLYEQEHKFYLERQAKIKAAMLKKFQEEQEKNRKGVFPNV
TDDDKDKGVAAKENVGTRPTLLRPLSQINVALRHMMVPAKLMSKFLILSMMNTEQNKETC
GILAGRLERDQLTISHLLIPKQVGTSDSCTTENEEEIFEYLDEHNLITLGWIHTHPSQTA
FLSSVDLHTHCSYQLMIPEALAIVCSPKNEENGFFILTPEHGLDVVANCRQTGFHPHPTE
PPLYKKAEHIAIEDLPVEIIDLRRK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaaataaaaaaccggatacgaattcattatttacggaagcagtttgtgaaggg
gattcgtttaattcacttgaatccccctcgttttctaccgatgaggctgtcgtgctcgaa
cctagtgctagaattaaggcacttgccgacagtggtaatgcattcgaagtcgatcatcac
atacctcccagaaaatattacagatctggacttgaaatggtccgtatggcagacgtttat
ctcaaagaagggagcctcgaaaatgcttatgttctttacatgaagttcatgacattattt
ttggaaaaaataagaaaacatcccaattttaagtctgtttcaattgttgatagagctcaa
aatgatgcaaaactcaaagaagttttgacaaaggctgaaaaattaaaaactaaattgtta
gacttatacgaacaagaacataagttttatttggaaagacaggcgaaaataaaagctgcc
atgttgaaaaagtttcaagaagagcaggagaaaaatcgaaaaggcgtttttccaaacgtg
acagatgatgataaagataaaggtgttgcagccaaagaaaatgtcggaacaagacctact
ttactaagaccattatcacaaatcaatgttgctctcaggcacatgatggtcccagcaaaa
ctcatgtcaaaatttttaatactttccatgatgaacactgagcaaaacaaagaaacttgt
ggaatattagctggacgtttggaaagggatcaactcacaatatctcatttattgattcct
aaacaagtgggaacttcagattcgtgcacgacagaaaacgaagaagaaatttttgaatat
ttagatgaacataatttgatcactttaggttggattcatactcatccgagtcaaacagct
tttctgtcgtctgtggatttacacactcattgttcttatcaattgatgatacccgaagct
ttggccatcgtttgctctccgaaaaatgaagaaaatggttttttcatattgactccagaa
cacggactcgacgttgttgccaattgcaggcaaacgggatttcatcctcatccaaccgag
cctcccttatacaagaaagcagaacacatcgccatcgaagatttacccgtcgaaatcata
gacttgagaagaaaataa

DBGET integrated database retrieval system