KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM229890Help
Entry
Phum_PHUM229890   CDS       T01223                                 

Definition
histone acetyltransferase Tip60, putative (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM229890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 468 aa AA seqDB search
MLSEEYDDPDAICESSASLVEGCRLPVRMRLGDDWPLAEIISIKDIKGIMQFYVHYVDFN
KRLDEWVTEERLDLRKVQFPRKDGTKETGCATPKRIGLGGGQIPNSGGSVTPQPVEKERQ
ASRPTSPVTPIQSDFISGSTRKGTFTESETNCVTDSLDGSPAAPRLTGSMVAHGSDDVVT
RMKNVEMIELGRHRIRPWYFSPYPQELVTLPCIYICEFCLKYTKTKKCLERHLAKCNLRH
PPGNEIYRKDTISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTDYDNR
GFHIVGYFSKEKESTEDYNVACILTLPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLS
DLGLLSYRSYWAQTILELLITAKPIGENEKPQITINEICELTSIKKEDVISTLQNLNLIN
YYKGQYIITLSAETITTHMAAMDKRKIRIDPKCLHWTPKDWSRRVHKW
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgttatcggaagaatatgacgatcctgatgcaatctgcgaatcttcggcatctttggtt
gaagggtgccgtttaccggttcgaatgcgtttaggagatgattggccactggcagaaata
attagtatcaaagacatcaaggggattatgcagttttatgttcattatgttgattttaac
aaaagattagacgaatgggtaacagaagaaagactggacttgcgaaaagttcagttccct
cgcaaagatggtaccaaagaaacaggttgtgccacaccaaaaagaataggcttaggagga
ggtcaaataccaaacagtggtggatcagttacacctcagcctgtggaaaaggaaagacaa
gcttcaaggccaacttctccggttactccgattcaatcggattttatcagtggatctaca
agaaaaggaacatttacagaatcagaaacaaattgtgtcactgattcattagatggttct
ccggcagctcctagacttacaggaagtatggttgctcatggttcagatgatgtagtcaca
agaatgaaaaatgtagaaatgatagaattaggacggcatagaatcagaccttggtacttt
tcaccttatcctcaagaacttgttacattaccatgcatttatatttgtgaattttgttta
aaatatacaaaaactaaaaagtgtttagaaaggcatttggctaagtgtaatttgagacat
cctcctggtaatgaaatttatagaaaagacacaatatcattttttgaaatcgatggacgt
aaaaacaaaaactatgcgcaaaatctatgtttattagccaagttattccttgatcacaaa
actttgtattacgatacagatccctttcttttttacgtaatgactgattatgacaatcgg
ggatttcacattgttggatatttttcaaaagaaaaagaatctaccgaagattataatgtt
gcatgcatacttaccttgcccccttatcaaagaaaaggatacgggaaattgttaattgaa
ttcagttacgaattatcaaaatttgaaggaaaaacagggtcacctgaaaaacctctatcg
gatttaggtttactttcgtatcggagttattgggctcaaaccattcttgaactgttaatc
acagctaaaccaataggagaaaatgaaaaacctcaaattacgataaatgaaatttgtgag
ttaactagtataaaaaaagaagacgttatttcaactctacaaaatttaaatttaattaat
tattataagggacaatacataattacattgagcgctgaaactataacaacgcacatggct
gccatggataaaagaaaaattagaatcgatcctaaatgtttacactggacaccaaaagat
tggtcaagaagagttcataaatggtaa

DBGET integrated database retrieval system