KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM231170Help
Entry
Phum_PHUM231170   CDS       T01223                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Phum_PHUM231170
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM231170
   04070 Phosphatidylinositol signaling system
    Phum_PHUM231170
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Phum_PHUM231170
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Phum_PHUM231170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MTKRFEFNWHIPVPEPLLSGGVFDRWTEEKDSTDFETGCLFKVDEYGFFIYWKSEGKEGD
VIELCQVSDIRAGGIPKDSRLCSQLINKHGHQLEEKSLTICSGTDYININYQHIICPDAA
TAKIWVDGLRSITHNVKANNFSPFTCLLKHWMRLGMLVDPKGKVSVKVVVRTFSSGKTEK
LVYQCLQELGLPSGKNDVIEPSDFTFDKFYALYHKICPRNDIEDLFQTISQGKAESISVS
QFITFLNEKQRDPRLNEILYPLYDEKRAVEIITTYEQDETARNEKRLTKDGLIRYLMSDE
NAPVFLDRLDIYMDMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGRSEDEEPIITHGKAMCTDILFKDVIHAIADCAFVTSDFPGQFIISDDEPKEDARAA
IVPIPEEKKEEVGDIVGEIPEIPPVQIQYTGSTTNVHPWLSSMVNYAQPIKFQGFDVADK
NNIHYNMSSFVETAGLGYLKSQAIEFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQ
MVSLNFQTADLPMQLNQGKFEYNGNCGYLLKPDFMRRSDRSFDPFAESPVDGVIAAQCAV
QVIAGQFLSDRKIGTYVEVDMYGLPTDTIRKEFRTRLVPSNGLNPVYNEEPFLFRKVVLP
DLAVLRFGVYDENGRLLGQRILPLDGLQAGYRHISLRTEANFPMSLPMLFCNIELKIYVP
DGFEDFMAALSDPRAFMSAQEKRAQQMKAMGIEETDIKDLKDGEVEDLKLEPINVDVLKS
EKGFQKTAKKQQKEIDILKKKQMKEKGLIEKNQCSAVEKVVKGRDKNDLTSDPMILKLVN
EQTQQWSEMQERHRKEEWELLKQHVLDQQEILKKLMKASQASQIKQIEAKHERIKEMNSR
QAKISVETMKEVK
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacgatttgaatttaattggcacataccagtgccagaaccactcctttccggt
ggtgtattcgatagatggacagaagaaaaagattcaaccgattttgaaactggttgttta
tttaaagttgatgaatatggattttttatttattggaaaagtgaaggcaaagaaggagat
gtcattgaattgtgtcaagtcagtgatatcagagcaggaggaattccaaaggattctaga
ctgtgtagtcaactcataaataagcatggtcatcaactggaagaaaaatctcttaccatt
tgcagtggaacagattatataaatataaattatcagcatatcatttgtcctgatgctgcg
acagccaagatttgggttgatggtctgagatcaattacgcacaacgtgaaagcaaataat
tttagtcctttcacttgcttattaaaacattggatgagacttggaatgttggtagatccc
aaaggaaaagtttccgttaaagtcgttgtcagaacgttttcatctggaaaaacggaaaaa
ttagtatatcaatgtcttcaagaactgggattacccagtggtaaaaacgatgttatcgaa
ccctccgattttactttcgacaaattttatgccttataccacaaaatttgtccgagaaac
gacatcgaagatttatttcaaactatatcgcaaggaaaagccgaatctataagtgtatct
caatttataacttttttaaatgaaaagcaaagggatccacgattgaatgaaatattatat
cccttatatgatgaaaaacgtgctgtggaaataataaccacgtacgaacaagatgaaact
gccagaaacgaaaaaagactaaccaaagatggtttgattcgttatttaatgtctgacgaa
aatgctcccgtttttcttgatcgtttggatatttacatggatatggatcaaccattatct
cattactatattaactcttcccataatacttatctgagtggaaggcagtttggtggaaaa
tcaagcgtggaaatgtaccgtcaggtccttttagctggatgtagatgtgttgaattggat
tgttgggatgggaggagtgaagatgaagaacccattataacgcatggaaaagccatgtgt
accgacattttattcaaggatgtgatacatgcgattgctgactgtgcttttgtaacatct
gattttccaggtcaatttataatatcagacgatgagccaaaagaagatgccagagctgcg
attgtaccgattcccgaagaaaaaaaggaagaagttggtgatattgttggtgaaattccc
gaaattcctcccgttcaaatccaatatactggatcaacgactaacgttcatccctggctc
tcatctatggtcaactacgctcaaccaattaaatttcagggttttgacgttgctgataaa
aacaacatacattacaacatgtcttcttttgtggaaacagctggattaggataccttaaa
tctcaagcaattgaatttgttaattacaacaaaaggcaaatgtcaagaatttatccaaaa
ggtacaagagctgattcttcaaattacatgcctcaggtattttggaacgccggttgccaa
atggtatcattaaattttcaaacagcggatcttccgatgcaacttaatcagggaaaattc
gaatacaatggaaattgtggttatttacttaaacctgatttcatgagacgcagcgatagg
tcatttgatcctttcgcagaaagtcccgtggacggagttatagccgcgcaatgtgccgtc
caggtgatagccggtcaatttttatcagacagaaaaataggtacatacgtcgaagtagat
atgtacggattacccaccgatacaatcagaaaagaatttagaacgagattggttccctca
aatggtttgaatccagtatacaacgaagaaccttttttatttagaaaagtcgtccttccc
gatttggctgtacttcgattcggggtttacgatgaaaatggaagattgttgggtcaaagg
attttaccattggacggtttacaagctggttatagacatatatccctgagaacggaagct
aattttccgatgtcattgccgatgcttttttgtaatattgaattaaaaatttacgttcct
gatggttttgaagattttatggcggctttgtcagatccgcgagcttttatgtcagcgcaa
gaaaaaagagcccaacaaatgaaagccatgggaatcgaggaaacagacataaaagatttg
aaggatggagaagtggaagatttaaaattggagccaatcaatgtggatgttttaaaatcg
gaaaaaggatttcaaaaaactgctaaaaaacagcaaaaagaaattgatatattaaaaaaa
aaacagatgaaagaaaaaggactcattgaaaaaaatcaatgttcggccgttgagaaagtt
gtcaaaggacgagacaaaaacgatttaacatcagatccgatgatattaaaacttgttaat
gaacaaactcaacaatggagcgaaatgcaagagagacatagaaaagaagaatgggaatta
ttaaagcaacacgttctagatcagcaagaaatattaaaaaaattaatgaaggcatcacaa
gcatctcaaataaaacaaatcgaagccaaacacgaaagaataaaagaaatgaattcacga
caagcgaaaatatccgtcgaaacgatgaaagaagtcaaatga

DBGET integrated database retrieval system