KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM235980Help
Entry
Phum_PHUM235980   CDS       T01223                                 

Definition
glycogen synthase, putative (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Phum_PHUM235980
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Phum_PHUM235980
Glycosyltransferases [BR:phu01003]
 Polysaccharide
  Storage polysaccharide
   Phum_PHUM235980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 704 aa AA seqDB search
MFKERASRRFYRVDSSHDFGSIMDHGQTASFQNRWTFEAAWEVCNKVGGIYTVIRSKAFV
STEEMGDQYVLLGPYKERSARTEVEETEFPMNQPLNQAVNNLREMGYKIVTGTWLVDGNP
QVILFDIGSGAWKLDEFKQELWEKSNLGIPHPDIEANDAVIFGFMVCEFLTEFQKLAEKH
HDQPPRIVAHFHEWQAGIGLIALRIRQVELATVFTTHATLLGRYLCAGNTDFYNNLDKFN
VDEEAGRRQIYHRYCVERAATHLANIFTTVSEITGLEAEHLLKRKPDIITPNGLNIKKFS
ALHEFQNLHAIAKEKIHEFVRGHFYGHYNFDLDKTLYFFIAGRYEFGNKGADIFIESLAR
LNHYLKSNHSDTTIVAFLIFPAPTQNFNVESLRGHAVTKSLRDTLQLIQNKIGKRMYEIC
LRGRMPDANELLLKEDQVKIKSCIYALQRDGLPPVTTHNVIDDYKDPVLNALRRCRLFNT
IHDRVKVVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEQIEDPMSYGIYIVDRRHISLESSVQQLAQFMYDFSRLNRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARVRALQAVFTDITFEEEESKGKRFNYPRPISEPPSPSSSR
HSSVHGSDNEEDEEDEVDDEKELQELGVNAKETQEMKMSQKTVS
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaaagagcatcgaggagattttatagagtggatagttcccatgattttggc
agtattatggatcatggtcaaactgctagttttcaaaatagatggacttttgaagctgcc
tgggaagtgtgcaataaagttggaggaatatatacagttatcagatcgaaagctttcgta
tcaactgaagaaatgggtgatcagtatgttttactcggcccatacaaagaaagaagtgct
agaactgaagtagaagaaactgaatttccaatgaatcaacctttaaatcaggcagttaat
aatttaagagaaatgggttataagattgttaccggtacatggcttgtcgatggaaaccct
caagttattctgtttgatattggatctggagcttggaaattggatgagtttaaacaagaa
ctgtgggaaaaatcaaatttaggtatacctcatccagatatcgaagctaatgatgctgtt
atttttgggttcatggtttgtgagttccttacagagtttcaaaaattagctgaaaaacat
catgatcaaccaccgcgtatagtcgctcattttcacgaatggcaagctggaataggactt
atcgctttgagaattagacaggtcgaattggcgacagtttttacaacgcatgcaacactt
ttaggtcgttatttgtgcgctggtaatacggatttttacaataatttggataagtttaat
gtcgatgaagaagcaggacggaggcaaatttatcataggtattgcgtcgaaagagcagca
actcatttagcaaatatatttacgacagtttccgaaataacaggtttggaagctgaacat
ttactcaagagaaaaccagacataatcactccgaacggtttaaatataaaaaaattttcc
gcattgcacgaatttcaaaatcttcacgccatcgcaaaggaaaaaattcacgaattcgta
cgcggtcatttttacggtcactacaatttcgatctcgataaaactttgtattttttcatc
gcgggaaggtacgaatttggtaacaaaggtgctgatatttttatagaatctctagctaga
ttaaatcattatttgaagagcaaccattcggatacgacgatagtagcttttcttatattt
cctgcgccaactcaaaatttcaacgtcgaaagtcttcgaggtcacgcggtaactaaaagt
ttaagagacacgttgcaattaattcaaaataaaattggaaagagaatgtacgaaatatgt
ttaagaggtcgaatgcctgacgccaacgaacttttattaaaagaagatcaagtgaaaata
aaatcttgtatttatgccttacaaagagatggtcttcctcccgtgacgacacacaacgtc
atcgatgattacaaggatcccgttttgaatgcgttgagaagatgtcgtttgtttaacaca
atacacgatcgcgttaaagttgtttttcatccagaatttttgtcgtcgacaaatccattg
tttgggttggactatgaagaatttgtgcgtggatgtcatcttggagtgtttccgagttat
tacgaaccctggggctacacgcctgccgaatgtactgttatgggaataccgagtataaca
actaacttatccggatttggttgttttatgcaagagcagattgaagatcccatgagttat
ggtatttacatcgttgacagacgtcacatatcactggaaagttccgttcaacagttggca
caatttatgtatgatttttcaagattaaacaggaggcaaagaataatccagagaaacaga
accgaacgattgagcgatttgttagactggagaaatttaggaatttattatcgacaagct
agagttcgagcattgcaagctgtttttacagacattactttcgaagaagaggaaagtaaa
ggaaagagatttaattatccaagacccatatcggaaccgccaagtccatctagtagcagg
cacagttccgtacacggttcggataacgaagaagatgaagaagatgaagtcgatgacgaa
aaggagttacaagaacttggagtaaacgcaaaagaaactcaagaaatgaaaatgagccaa
aagactgtatcatga

DBGET integrated database retrieval system