KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM236690Help
Entry
Phum_PHUM236690   CDS       T01223                                 

Definition
protein O-mannosyltransferase, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Phum_PHUM236690
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Phum_PHUM236690
Glycosyltransferases [BR:phu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Phum_PHUM236690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 739 aa AA seqDB search
MDKKINVIDKTQQQQQQPLCNKKNVNQANSIQSKKKIETDVNKNNDEEQEDYQLSFKFKV
DMVASFLFVISLITRFYKLEEPRFVVFDELHYGKYISLYLKKIFFFDSHPPLGKQLVSLA
TFFSGFNGHLKFEKIGSAYGEDIPLFTLRFVPAFCGTLLVPVAYHVMLELGFRQWTATVA
GLLLVCDNALLTQSRFLLMESILLFFAIFGLLCILKFKKHSLKFHNSSWCFWLTLSFASL
TCSLCVKYVGIFSYLLGLWIVAYSCWEMLSNQNISIRSILFYSLGKLFIAIFVSVGVYLL
IFYLHLSFLTKAGPHDSVMTSAFQASLEGGLASITKGQPLEVGHGSQITLRHTFGRTCWL
HSHVHVYPLRYPDKRGSSHQQQVTCYSFKDVNNWWIVKRPDRNDLRVSEPVDVIRHGDVI
QLVHGITSRALNSHDVAAPMSPQNQEVSCYVDYNVSMLPQSLWTVDIVNREQFGDVWLSI
QSQVRLIHLNSSQALKFSGRQLPDWGFNQHEIVTDRIINQPDTVWNVEEHRYTKSEDQKE
RERDLVNAEMIPTKATTLSFWEKMAELQFKMLFSYQEPLQSHMYSSEPIEWPLLKRTTAY
WVSHNSNAQIHLLGNILIWYSGVFGVFSYIILLTYYSLRRRRHCFDLPDNEWEKFCKMGN
ILGVAYFLHYLPYFFMDKTLFLHHYLPALVFKIMLTAAVLEHFHFILRYIAIGSFKMEND
SEIFENNNFFLVRLDYLDI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaaaattaatgttattgacaaaacacaacaacaacaacaacaacctttatgt
aacaaaaaaaatgttaatcaagcaaattccattcaatctaaaaagaaaattgagactgat
gtaaataaaaataatgatgaagaacaagaagattatcaattatcatttaaatttaaagtt
gatatggttgccagttttttgtttgtgattagtttaataacaaggttttataaacttgaa
gaacccaggtttgttgttttcgatgaattacattatggaaaatacataagtttgtatttg
aaaaaaatttttttttttgattctcatccaccacttggtaaacaacttgtatctcttgct
acttttttctccggttttaatggacatttaaaatttgaaaaaattgggagcgcctatggt
gaagatatcccacttttcactctaagatttgttcctgctttttgtggtaccttattagta
cccgttgcttatcacgtcatgttagaattaggttttagacaatggacagcaaccgtagcc
ggacttttacttgtatgtgataacgctcttctcactcagtcaagatttttactcatggaa
tcaattcttcttttttttgccattttcggtttgttatgcattttgaaatttaagaagcac
agcttaaaatttcataattcatcctggtgcttttggcttaccctgtcatttgcatcattg
acatgttcattgtgcgttaaatacgttggaattttttcatatttactcggtttatggata
gtggcttattcctgttgggaaatgctcagcaatcaaaatatttctattcggtcaatatta
ttttattcattaggaaaattgttcattgctatttttgttagtgttggagtttacttatta
attttttatttacatttgtcctttttgacaaaagccggtcctcacgatagcgtaatgacg
agtgcttttcaagctagcttagaaggaggattagcttctataactaaaggtcaaccactt
gaagtcggccacggttctcaaatcacgttgagacacactttcggacgtacctgttggttg
cattcccacgttcatgtataccctttaaggtatcctgataaaagaggatcatctcatcaa
cagcaagttacttgttattcttttaaagatgtcaataattggtggatagttaaaagaccc
gatcgtaacgatttaagggtatctgaacctgttgatgttatacgtcatggagacgtgatt
caactcgttcatggtattaccagtcgcgcgttaaattctcacgatgtagctgcaccaatg
tctccacaaaatcaagaagttagttgttacgttgactacaacgtttccatgttgcctcaa
agtttatggacggtggatatcgtaaatcgcgaacaatttggagatgtttggctttcaatt
caatctcaggtgagattgattcatctcaattcttctcaagcattaaaatttagtggtcgt
caattacctgattggggtttcaatcagcacgaaatagtgacggatcgtattattaatcaa
cccgacaccgtttggaatgttgaggagcatcgatatactaaaagtgaagatcaaaaagaa
agagaaagagatttagttaatgctgaaatgattccaaccaaagcaacaactttgagtttt
tgggaaaaaatggcggaacttcaatttaaaatgttattttcataccaagaaccccttcaa
agtcacatgtattcaagtgaacctatagaatggcctttattaaaaagaactacagcctat
tgggtatctcataatagcaacgctcaaattcacctcttgggaaatatattgatttggtac
tcgggagtgtttggtgttttttcttacataatattattaacatattattcgttgaggaga
agacgacattgttttgatcttccagataatgaatgggaaaaattttgcaaaatgggaaat
attcttggagttgcttattttcttcattatttgccgtattttttcatggataaaactttg
tttctacatcactaccttccagccttagtttttaaaataatgttaaccgcagcagtttta
gaacattttcattttattttaaggtacattgccatcggaagttttaaaatggaaaacgat
agcgaaatttttgaaaataacaatttttttctggtgcgcttggattatttggatatttaa

DBGET integrated database retrieval system