KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM238600Help
Entry
Phum_PHUM238600   CDS       T01223                                 

Definition
(RefSeq) 3-hydroxyacyl-CoA dehyrogenase, putative
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00062  Fatty acid elongation
phu00071  Fatty acid degradation
phu00280  Valine, leucine and isoleucine degradation
phu00310  Lysine degradation
phu00380  Tryptophan metabolism
phu00410  beta-Alanine metabolism
phu00640  Propanoate metabolism
phu00650  Butanoate metabolism
phu01040  Biosynthesis of unsaturated fatty acids
phu01100  Metabolic pathways
phu01200  Carbon metabolism
phu01212  Fatty acid metabolism
Module
phu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
phu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
phu_M00085  Fatty acid biosynthesis, elongation, mitochondria
phu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Phum_PHUM238600
   00650 Butanoate metabolism
    Phum_PHUM238600
  Lipid metabolism
   00062 Fatty acid elongation
    Phum_PHUM238600
   00071 Fatty acid degradation
    Phum_PHUM238600
   01040 Biosynthesis of unsaturated fatty acids
    Phum_PHUM238600
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Phum_PHUM238600
   00310 Lysine degradation
    Phum_PHUM238600
   00380 Tryptophan metabolism
    Phum_PHUM238600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phum_PHUM238600
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Phum_PHUM238600
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Phum_PHUM238600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 8230419
NCBI-ProteinID: XP_002426143
VectorBase: PHUM238600
UniProt: E0VJ49
AA seq 773 aa AA seqDB search
MALVRLSGVFSQISKSNSKFLRCTGISRKFSNAPKENKHLKLKKVDDVYVVTIDNVGSKM
NVLNNEVMEEFQSLIPAVQNDPSISSVVLISGKPNVFIAGADIDMLAAAKTKEEIVQISK
SGQKILQLIEDSKKPFIAAIKGSCLGGGLEVALACHYRLAMMDKSTKLGLPEIKLGLLPG
AGGTQRMPKLVSLPNAIEMCSSGKEVRADRAKKMGLIDMVVKPLGPGLKPANDRFSYLEE
VAVFIAKKIASGEISLDRESKKGTIQKLTDSVMGIGFVKNLIFNKAREQITKATKGFYPA
PLKALEVIKKGVENPEEGFQAEAEAFGELAMTPQSKGLIGLYYGMKACEKNRFGAPQKEA
NSIAVIGSGLMGAGIAQVTVNKKIPCVMKDVNESGLQRGLAQIQKNFATAVKRKQLSTMD
RALYLSHLYPTLSYDRLKDVDCIVEAVFEDLNIKHKVIKEIEAVVPPHCVIATNTSAIPI
SKVAEGSRNPSKVIGMHYFSPVDKMMLLEIIATKQTSKDTCAVAVDVGLRQKKLVIVVGD
GPGFYTTRILSAMLAEALRLLQLKIIKFIFFLQEGVDVVSLDKLTEKFGFPVGCSTLVDE
VGIDVASHIAVDLSKAFGTRFGGGDPNILKDLVNAGFLGRKSGKGCFVYGTGQKVKPVNS
DAVTILEKYKTTPPAPLVDEDSQMRLVGRFVNEAVLCLQENILDNPTEGDIGAVFGLGFP
PFTGGPFRWLDTYGCDKFVSQMEKYAALYGESFKPCQLLLDHSKDSSKKFHKR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggtcagattgtcaggtgtatttagccaaatttcaaagtctaattcaaagttt
ttaagatgcaccggtataagcagaaaattttcaaatgccccaaaagaaaacaaacactta
aaattaaaaaaagtagatgatgtttatgttgtaacaattgataatgttggctcgaaaatg
aatgttcttaataacgaagtaatggaagaatttcagtcacttattcctgcagttcaaaat
gatccatcaatttcatcagtggttttaatatcagggaaaccaaatgtattcatagcggga
gcagacatagatatgttagcagctgctaaaactaaggaagaaatagtgcaaatttcaaaa
tcaggtcaaaagattttacagctcattgaagactctaagaaaccttttattgctgcgatt
aaaggttcctgtttaggaggtggattagaagtagccttagcttgtcattatagactagca
atgatggataaatctacaaaacttgggttacctgaaatcaagttagggttattaccaggt
gcaggaggtactcagagaatgcccaagcttgtttcacttcctaatgctattgaaatgtgt
tcaagcggcaaagaagtgagagctgacagagcgaaaaaaatgggattgattgacatggta
gttaagcccctaggacctggacttaagccagctaatgacagattttcatatttggaagaa
gtagctgttttcattgccaaaaaaattgcatctggagaaataagcctggatagggaatcc
aaaaaaggaaccattcaaaaactaaccgattcagttatgggaataggttttgtaaaaaat
ttaatttttaataaagctagagaacaaattacaaaggcaaccaaaggattttatccagct
cctcttaaagctttagaggttattaaaaaaggtgtagaaaatcctgaagaaggatttcaa
gcagaagccgaagcttttggagaattggccatgaccccacaatcaaaaggtttaattgga
ctttattacggaatgaaagcttgtgagaaaaatcgatttggagctcctcaaaaagaagca
aactctatagcggtaattggttccggtctgatgggagcaggtatagcacaagttacggta
aataaaaaaattccttgcgtcatgaaagatgttaatgaaagtggattgcaacgaggtttg
gcacaaatacaaaaaaattttgcaactgctgtgaaaagaaaacaattgtctacaatggat
cgcgccttgtatttgagtcatctttaccctactctttcttacgacagattaaaagacgta
gattgtatagtagaagctgtatttgaagacttaaatattaaacacaaagttattaaagaa
atcgaagctgtggtgcctcctcattgcgttatcgccaccaataccagtgctattcctatc
agcaaagttgctgaaggcagtaggaatccgtctaaagttataggtatgcattacttttct
cccgttgataaaatgatgctactggaaattatagcaaccaaacaaacatcaaaagacacg
tgtgctgtagctgttgatgtgggcctgcggcaaaaaaaattagttattgtagtaggtgat
ggtcctggattttatacgacaagaattttgagtgcaatgttggcggaagctcttcggctt
ttacagttaaaaattattaaatttattttttttttacaggaaggagttgatgtagtatca
ctagataaactgactgaaaaatttggatttcctgtaggttgttctacgttggtcgatgaa
gttggtatagatgttgccagccacattgctgttgatttaagcaaagcttttggtacacga
ttcggaggaggtgatccaaacattttgaaagatttggtcaatgctggatttttgggtagg
aaatcagggaaaggatgttttgtttatggaactggacaaaaagtaaaacctgtgaattca
gatgctgttactatattagaaaaatacaaaacgactcctccagcacctttagtagatgaa
gatagtcaaatgagattagtaggtcgttttgttaatgaagccgttctgtgccttcaagaa
aatattctagataacccgactgaaggagatattggtgcagtttttggattaggctttcca
ccctttacgggaggtcccttccgatggttggatacatacggatgtgacaaattcgttagc
caaatggaaaaatatgcggctctttatggtgaatcttttaagccatgtcaattattattg
gatcactcaaaggattcttcaaagaagttccataaaaggtaa

DBGET integrated database retrieval system