KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM238630Help
Entry
Phum_PHUM238630   CDS       T01223                                 

Definition
protein O-mannosyl-transferase, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:phu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 601 aa AA seqDB search
MAQKHKKNNSKESNTNGWWHFFVIITLTILTRFYKVAEPDHVCWDETHFGKMGSWYINRT
FFFDVHPPLGKMLIALSGYLTGYDGTFPFEKPGDKYENINYFGMRMFCTMMGASIVPFSF
ITVWELTKSKMSAFLSASFILLDVGMVTLTQYILLDPILLFFVSGSVMGMVKVKGNQKKS
FSLKWWLWLIFTGIMLAGAVSVKFVGLFVILLVGIFTVVELWEIFGDLSLPVIFTVKHFI
ARTLCLIILPILLYVSYFYIHLVVLNKSGNGDGFYSSAFQSKLIEQAPITKKHFQVTGYG
ENGTGDANDIWKVIIDGTDEIIPVKTVTSKVKFIHYLQHCILTTTSKQLPKWAYEQQEVT
CNPNIRDVNALWNVEDNFFPKLPNVSFDVYAPGFFERFFESHAVMFQGNAGLKPKEGEVT
SRPWQWPLNYRGQFFSGSNYKIYLLGNPIIWWSNLSLLPIAVLIIFYDAILSKRGITTSK
EITESRKRMVNACLWLFIGWFVHYAPFWTMARVLYFHHYFPAVYFSSMLSGVVIDYFLQA
ISKFFSENWTNVLYHWSLGIILSSTYYSFYLFSPLAYGMISEGNETYSEMNNLRWLESWE
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaaacacaaaaaaaataattctaaagaatcgaacaccaatgggtggtggcat
ttttttgttattattactttaacaattttaactagattttataaagttgctgagccagac
catgtttgttgggatgaaacacattttggaaaaatggggagttggtacataaacaggaca
tttttttttgatgtacatcccccattgggaaaaatgttaattgctttgtcaggatattta
actggttatgatggaacatttccttttgaaaaaccaggagataaatatgaaaatattaat
tattttggaatgagaatgttttgcacaatgatgggagcttcaattgttcctttttcattt
attactgtttgggagcttacaaagtccaaaatgagtgcttttctaagtgcctcttttata
ttattagatgttggtatggtgactcttactcaatacattttgttagatcctattctatta
ttttttgttagtggatctgtcatgggaatggttaaagttaaaggaaatcaaaaaaaatcc
ttttctttaaaatggtggctttggttaatatttactggaattatgctagcaggagcagtc
agtgtaaagtttgttggtttatttgttattttacttgttggaatttttacagttgttgag
ttgtgggaaatttttggagatttatctttacctgtgatttttactgttaaacatttcatt
gctagaactctatgtcttataattttgccaatcctcctctatgtttcgtacttttacatt
cacttagtggtgctcaataaaagtggaaatggagatggattttattcgtctgcatttcaa
tccaaacttatagaacaagctcccataacgaagaagcattttcaagttacaggatatggg
gagaacggaacgggagatgctaatgatatttggaaagtaattattgatggaaccgatgaa
ataattccagtcaaaaccgtaactagtaaagtaaagtttattcattacttacaacattgt
attcttacaacgacttcaaaacaattaccaaaatgggcttatgaacaacaagaagtcact
tgtaatccaaatataagagatgtaaatgcactctggaatgtagaggataacttttttcca
aaacttcctaatgtaagctttgatgtttacgctccaggatttttcgagagatttttcgaa
tcgcatgccgttatgtttcaaggaaatgctggcctaaaacctaaagaaggagaagttaca
tcacgcccttggcaatggcctttaaattatcgaggacagtttttttctggaagcaattac
aaaatttacttactaggaaatccaatcatttggtggagtaatttatctcttttacccatt
gctgtcttgattattttttatgatgcaatcctaagtaaaagaggaatcaccacaagtaaa
gaaatcacagaatctcgaaaaagaatggtcaacgcatgcctttggctatttattggatgg
tttgttcactatgctccattttggacaatggcaagagttttatattttcatcactatttt
ccagctgtatatttttcatcaatgctatctggagtagttattgattattttttgcaagct
atatctaaattcttttctgaaaattggactaatgttttatatcattggagccttggaatt
attctgtcaagtacttattacagtttttatctattttcaccattggcttacggcatgata
agtgaaggaaatgaaacttatagcgaaatgaataatttaaggtggttggagtcttgggaa
ttttga

DBGET integrated database retrieval system